Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428Q5Q3

Protein Details
Accession A0A428Q5Q3    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
95-121FLYRTRSRTGRKILWRRKLKGRKNIAQHydrophilic
NLS Segment(s)
PositionSequence
92-118RHGFLYRTRSRTGRKILWRRKLKGRKN
Subcellular Location(s) mito 22.5, cyto_mito 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MFRSVTRLVRPVLTSPLAQSPRTFTTFVPLRPSLTPSTVRRTVLPSSFTPTASADLVPSTAISAHPAMGDMQIRCGPRNTMNGATRLVQKRRHGFLYRTRSRTGRKILWRRKLKGRKNIAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.26
3 0.33
4 0.32
5 0.31
6 0.29
7 0.29
8 0.31
9 0.33
10 0.32
11 0.23
12 0.29
13 0.33
14 0.34
15 0.36
16 0.32
17 0.32
18 0.32
19 0.36
20 0.29
21 0.28
22 0.32
23 0.29
24 0.35
25 0.36
26 0.36
27 0.34
28 0.36
29 0.36
30 0.32
31 0.32
32 0.26
33 0.28
34 0.28
35 0.27
36 0.24
37 0.21
38 0.2
39 0.17
40 0.16
41 0.09
42 0.08
43 0.08
44 0.07
45 0.06
46 0.04
47 0.04
48 0.04
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.07
56 0.09
57 0.08
58 0.1
59 0.13
60 0.14
61 0.14
62 0.15
63 0.16
64 0.18
65 0.22
66 0.24
67 0.28
68 0.29
69 0.31
70 0.31
71 0.31
72 0.35
73 0.38
74 0.4
75 0.4
76 0.46
77 0.51
78 0.54
79 0.6
80 0.57
81 0.56
82 0.61
83 0.65
84 0.66
85 0.64
86 0.63
87 0.62
88 0.63
89 0.66
90 0.65
91 0.63
92 0.65
93 0.72
94 0.78
95 0.82
96 0.86
97 0.85
98 0.87
99 0.89
100 0.88
101 0.87