Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428QG68

Protein Details
Accession A0A428QG68    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
60-83GTYGAKPKPKPKPAKPAPKKYTNYHydrophilic
155-183YGTYGAKPKPKPKAKPAPKKPAPKKYTTYHydrophilic
NLS Segment(s)
PositionSequence
65-79KPKPKPKPAKPAPKK
161-179KPKPKPKAKPAPKKPAPKK
Subcellular Location(s) extr 17, cyto 3, mito 2, E.R. 2, golg 2
Family & Domain DBs
Amino Acid Sequences MKLSAITLLALAAGAIAAPAPAPEAEVAPQEEKREASPGYASYGDYKGAGENLPSYPSYGTYGAKPKPKPKPAKPAPKKYTNYGSYNYKKYGSYGSYKREEVEKREAEPEVEVEKREAEPEVEVDVEKREASPGGYATYGDYKGAGENLPSYPSYGTYGAKPKPKPKAKPAPKKPAPKKYTTYGSYSYKKYGSYGAYKRTTDWIKSWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.04
9 0.05
10 0.06
11 0.07
12 0.08
13 0.11
14 0.14
15 0.16
16 0.17
17 0.19
18 0.2
19 0.2
20 0.2
21 0.22
22 0.2
23 0.19
24 0.2
25 0.18
26 0.2
27 0.2
28 0.19
29 0.18
30 0.19
31 0.17
32 0.15
33 0.15
34 0.12
35 0.12
36 0.11
37 0.09
38 0.1
39 0.1
40 0.12
41 0.11
42 0.12
43 0.11
44 0.12
45 0.14
46 0.14
47 0.14
48 0.17
49 0.24
50 0.28
51 0.35
52 0.39
53 0.45
54 0.53
55 0.62
56 0.69
57 0.7
58 0.77
59 0.8
60 0.86
61 0.87
62 0.88
63 0.86
64 0.85
65 0.8
66 0.74
67 0.73
68 0.67
69 0.6
70 0.53
71 0.56
72 0.51
73 0.52
74 0.48
75 0.4
76 0.35
77 0.32
78 0.32
79 0.25
80 0.27
81 0.29
82 0.32
83 0.34
84 0.34
85 0.34
86 0.36
87 0.36
88 0.34
89 0.37
90 0.33
91 0.32
92 0.33
93 0.33
94 0.26
95 0.24
96 0.2
97 0.14
98 0.13
99 0.12
100 0.1
101 0.11
102 0.11
103 0.11
104 0.1
105 0.08
106 0.07
107 0.08
108 0.08
109 0.07
110 0.07
111 0.07
112 0.08
113 0.08
114 0.07
115 0.07
116 0.07
117 0.07
118 0.07
119 0.08
120 0.08
121 0.09
122 0.09
123 0.09
124 0.09
125 0.12
126 0.11
127 0.1
128 0.09
129 0.09
130 0.09
131 0.1
132 0.09
133 0.07
134 0.09
135 0.09
136 0.11
137 0.11
138 0.11
139 0.11
140 0.12
141 0.14
142 0.14
143 0.14
144 0.17
145 0.24
146 0.28
147 0.35
148 0.39
149 0.44
150 0.53
151 0.62
152 0.67
153 0.7
154 0.77
155 0.81
156 0.87
157 0.9
158 0.91
159 0.9
160 0.93
161 0.92
162 0.92
163 0.87
164 0.84
165 0.79
166 0.76
167 0.76
168 0.68
169 0.63
170 0.59
171 0.61
172 0.59
173 0.57
174 0.53
175 0.46
176 0.43
177 0.39
178 0.37
179 0.35
180 0.39
181 0.43
182 0.47
183 0.52
184 0.52
185 0.52
186 0.56
187 0.56
188 0.5