Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NXY0

Protein Details
Accession A0A428NXY0    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
48-71SGYAITKKIQKKRQEKKAAARAAEHydrophilic
NLS Segment(s)
PositionSequence
55-65KIQKKRQEKKA
Subcellular Location(s) mito 10, nucl 6, cyto 4, extr 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPFSMADLNKRDETASKIPAPGKGFGALFGGAGYAQVVCCPLSVIFWSGYAITKKIQKKRQEKKAAARAAEDGAVGNSDRTNNNIDVEEKTEGNRPRRVSPKTGPKEMPGTLPLHPTLQQHPNNPRVCDPECPGHGKDFCFAHQGKRPSRPTSPGLLAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.36
3 0.33
4 0.37
5 0.38
6 0.42
7 0.42
8 0.37
9 0.32
10 0.29
11 0.26
12 0.22
13 0.22
14 0.17
15 0.14
16 0.11
17 0.09
18 0.06
19 0.06
20 0.06
21 0.04
22 0.04
23 0.04
24 0.05
25 0.05
26 0.05
27 0.06
28 0.06
29 0.06
30 0.08
31 0.09
32 0.09
33 0.09
34 0.1
35 0.09
36 0.12
37 0.12
38 0.12
39 0.13
40 0.2
41 0.27
42 0.36
43 0.43
44 0.5
45 0.6
46 0.7
47 0.78
48 0.82
49 0.82
50 0.84
51 0.85
52 0.81
53 0.71
54 0.61
55 0.52
56 0.42
57 0.34
58 0.24
59 0.14
60 0.08
61 0.08
62 0.06
63 0.05
64 0.05
65 0.06
66 0.06
67 0.07
68 0.1
69 0.1
70 0.11
71 0.12
72 0.13
73 0.12
74 0.15
75 0.15
76 0.12
77 0.13
78 0.18
79 0.23
80 0.27
81 0.31
82 0.31
83 0.37
84 0.45
85 0.48
86 0.49
87 0.52
88 0.59
89 0.6
90 0.64
91 0.59
92 0.54
93 0.54
94 0.48
95 0.42
96 0.33
97 0.29
98 0.24
99 0.25
100 0.22
101 0.19
102 0.21
103 0.21
104 0.23
105 0.3
106 0.33
107 0.39
108 0.45
109 0.52
110 0.55
111 0.55
112 0.53
113 0.5
114 0.48
115 0.46
116 0.43
117 0.42
118 0.4
119 0.43
120 0.41
121 0.42
122 0.42
123 0.38
124 0.38
125 0.33
126 0.31
127 0.33
128 0.33
129 0.33
130 0.39
131 0.46
132 0.5
133 0.57
134 0.63
135 0.63
136 0.68
137 0.67
138 0.63
139 0.62