Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NXY7

Protein Details
Accession A0A428NXY7    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
160-198ASALRDRRHSRSRSRSRSPSEATVSRRDSRRSRSPRRREHydrophilic
NLS Segment(s)
PositionSequence
20-25KRGGKK
166-198RRHSRSRSRSRSPSEATVSRRDSRRSRSPRRRE
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MTKDGKHVKTAAVPPPSGQKRGGKKTVFRSKFNSLARRWRSALRDASASQTPAQPAFASSPGSIASPAGSQQSPFDLTSSALVVASQGITPSRRGAANPGVSPFQFNQLVQATGMAMNQLASESRDTRSVIDRLVTGQEQARQDQNRSNETLVLALSQLASALRDRRHSRSRSRSRSPSEATVSRRDSRRSRSPRRRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.49
3 0.51
4 0.46
5 0.44
6 0.45
7 0.5
8 0.58
9 0.66
10 0.62
11 0.65
12 0.73
13 0.79
14 0.76
15 0.71
16 0.69
17 0.67
18 0.69
19 0.69
20 0.67
21 0.61
22 0.66
23 0.67
24 0.66
25 0.61
26 0.59
27 0.55
28 0.55
29 0.55
30 0.47
31 0.46
32 0.41
33 0.43
34 0.38
35 0.35
36 0.28
37 0.24
38 0.23
39 0.18
40 0.18
41 0.14
42 0.13
43 0.14
44 0.14
45 0.14
46 0.12
47 0.13
48 0.12
49 0.12
50 0.11
51 0.09
52 0.08
53 0.06
54 0.07
55 0.09
56 0.08
57 0.08
58 0.09
59 0.1
60 0.12
61 0.12
62 0.11
63 0.1
64 0.1
65 0.1
66 0.1
67 0.08
68 0.06
69 0.06
70 0.05
71 0.05
72 0.05
73 0.04
74 0.04
75 0.05
76 0.06
77 0.06
78 0.07
79 0.08
80 0.09
81 0.09
82 0.13
83 0.18
84 0.2
85 0.2
86 0.2
87 0.2
88 0.2
89 0.21
90 0.17
91 0.16
92 0.14
93 0.13
94 0.14
95 0.14
96 0.15
97 0.13
98 0.13
99 0.09
100 0.08
101 0.08
102 0.05
103 0.04
104 0.04
105 0.04
106 0.04
107 0.04
108 0.05
109 0.07
110 0.08
111 0.09
112 0.11
113 0.12
114 0.14
115 0.18
116 0.18
117 0.17
118 0.16
119 0.16
120 0.15
121 0.17
122 0.16
123 0.12
124 0.13
125 0.17
126 0.18
127 0.2
128 0.25
129 0.25
130 0.27
131 0.32
132 0.34
133 0.34
134 0.35
135 0.34
136 0.28
137 0.26
138 0.25
139 0.19
140 0.15
141 0.11
142 0.08
143 0.07
144 0.06
145 0.05
146 0.05
147 0.06
148 0.08
149 0.13
150 0.16
151 0.24
152 0.29
153 0.37
154 0.47
155 0.53
156 0.62
157 0.68
158 0.76
159 0.78
160 0.83
161 0.85
162 0.84
163 0.85
164 0.81
165 0.77
166 0.73
167 0.7
168 0.65
169 0.64
170 0.63
171 0.61
172 0.61
173 0.61
174 0.62
175 0.64
176 0.7
177 0.72
178 0.77