Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NFK4

Protein Details
Accession A0A428NFK4    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
12-40TAQDKTTADTRRKREKRRKVAARERGLPYHydrophilic
NLS Segment(s)
PositionSequence
22-35RRKREKRRKVAARE
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences PTGRGRPRKYATAQDKTTADTRRKREKRRKVAARERGLPYSNFYNLHLPSTMPPGDYGHPMEHLDTAESSLAAAIDNNRDISNFLPPPSPPLQPINEEVSFNDGEPLGAVSTLPSSDGPEVDSHGQLMVPAYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.6
3 0.55
4 0.55
5 0.52
6 0.5
7 0.49
8 0.55
9 0.6
10 0.69
11 0.77
12 0.82
13 0.86
14 0.89
15 0.91
16 0.93
17 0.93
18 0.94
19 0.93
20 0.9
21 0.87
22 0.8
23 0.73
24 0.65
25 0.54
26 0.47
27 0.4
28 0.34
29 0.28
30 0.25
31 0.25
32 0.24
33 0.24
34 0.21
35 0.18
36 0.16
37 0.2
38 0.18
39 0.13
40 0.13
41 0.14
42 0.14
43 0.16
44 0.17
45 0.12
46 0.13
47 0.13
48 0.13
49 0.12
50 0.11
51 0.09
52 0.07
53 0.07
54 0.06
55 0.05
56 0.05
57 0.04
58 0.04
59 0.03
60 0.04
61 0.04
62 0.05
63 0.06
64 0.07
65 0.07
66 0.07
67 0.08
68 0.08
69 0.14
70 0.14
71 0.14
72 0.15
73 0.15
74 0.21
75 0.23
76 0.24
77 0.2
78 0.23
79 0.25
80 0.25
81 0.29
82 0.29
83 0.27
84 0.27
85 0.24
86 0.24
87 0.22
88 0.19
89 0.17
90 0.11
91 0.1
92 0.1
93 0.1
94 0.06
95 0.06
96 0.06
97 0.05
98 0.06
99 0.06
100 0.07
101 0.06
102 0.09
103 0.1
104 0.1
105 0.11
106 0.11
107 0.15
108 0.17
109 0.17
110 0.15
111 0.14
112 0.14
113 0.13