Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428QEM8

Protein Details
Accession A0A428QEM8    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
75-99APSVPVKKATPRKRKVNKKVDSEDDHydrophilic
NLS Segment(s)
PositionSequence
81-92KKATPRKRKVNK
113-114RK
Subcellular Location(s) nucl 13.5, cyto_nucl 11.5, cyto 8.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSEGTPTGKANAWTEEAKNEFLLRIIMQLKPEGKGINWSEVQMPGRTVKSLQNQWTAVNKKIDALRQQQQDGGDAPSVPVKKATPRKRKVNKKVDSEDDDDGTYVGPKKSGSRKRGNTETPERAAKAIKAEAAELEDFQVKDEPAFEADSEHGQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.3
3 0.3
4 0.28
5 0.27
6 0.24
7 0.21
8 0.18
9 0.18
10 0.13
11 0.15
12 0.15
13 0.16
14 0.16
15 0.21
16 0.21
17 0.21
18 0.23
19 0.19
20 0.17
21 0.24
22 0.25
23 0.26
24 0.25
25 0.24
26 0.24
27 0.26
28 0.28
29 0.21
30 0.2
31 0.18
32 0.18
33 0.18
34 0.18
35 0.21
36 0.26
37 0.32
38 0.35
39 0.37
40 0.37
41 0.39
42 0.45
43 0.43
44 0.39
45 0.36
46 0.32
47 0.29
48 0.31
49 0.32
50 0.3
51 0.33
52 0.35
53 0.36
54 0.36
55 0.35
56 0.33
57 0.3
58 0.26
59 0.21
60 0.14
61 0.1
62 0.1
63 0.11
64 0.11
65 0.1
66 0.1
67 0.09
68 0.17
69 0.27
70 0.38
71 0.45
72 0.53
73 0.65
74 0.74
75 0.85
76 0.88
77 0.89
78 0.86
79 0.85
80 0.83
81 0.79
82 0.74
83 0.66
84 0.57
85 0.47
86 0.39
87 0.3
88 0.23
89 0.17
90 0.13
91 0.11
92 0.09
93 0.09
94 0.1
95 0.16
96 0.26
97 0.35
98 0.42
99 0.51
100 0.59
101 0.67
102 0.75
103 0.76
104 0.74
105 0.75
106 0.73
107 0.67
108 0.62
109 0.55
110 0.48
111 0.43
112 0.36
113 0.31
114 0.26
115 0.24
116 0.2
117 0.2
118 0.18
119 0.19
120 0.18
121 0.14
122 0.14
123 0.15
124 0.14
125 0.15
126 0.17
127 0.14
128 0.14
129 0.15
130 0.15
131 0.13
132 0.15
133 0.13
134 0.13
135 0.14