Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428R9V9

Protein Details
Accession A0A428R9V9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
13-35ESLKIYFDHKQKHKRRDLSDDKEBasic
50-73PPNGTTRDAKERRKRRLRLALIILHydrophilic
NLS Segment(s)
PositionSequence
59-66KERRKRRL
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 8
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MYHLRKPLCKVQESLKIYFDHKQKHKRRDLSDDKEVVGAKTAYFNTTSEPPNGTTRDAKERRKRRLRLALIILGRIGLVALQLGVILGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.49
3 0.44
4 0.42
5 0.46
6 0.44
7 0.43
8 0.48
9 0.56
10 0.62
11 0.7
12 0.78
13 0.8
14 0.8
15 0.81
16 0.83
17 0.8
18 0.78
19 0.7
20 0.6
21 0.53
22 0.47
23 0.36
24 0.27
25 0.19
26 0.11
27 0.12
28 0.11
29 0.1
30 0.1
31 0.1
32 0.1
33 0.13
34 0.15
35 0.13
36 0.15
37 0.16
38 0.19
39 0.2
40 0.21
41 0.21
42 0.23
43 0.33
44 0.39
45 0.47
46 0.54
47 0.62
48 0.71
49 0.78
50 0.81
51 0.81
52 0.85
53 0.82
54 0.8
55 0.77
56 0.73
57 0.64
58 0.58
59 0.47
60 0.36
61 0.28
62 0.19
63 0.13
64 0.05
65 0.04
66 0.03
67 0.03
68 0.03
69 0.03