Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428PV59

Protein Details
Accession A0A428PV59    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
79-112VCCWYPCCRPRPQDRQRRRRRRRGPPPSDEEENAHydrophilic
NLS Segment(s)
PositionSequence
91-104QDRQRRRRRRRGPP
Subcellular Location(s) plas 12, nucl 4, mito 3, cyto 3, extr 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPASPMLLLLSRGEHSSSPEEDSSSTAGTTGSLVPTDSFANDLFRDKFMGIAKGGSNGEKIMRGFLIGLAIGLIVACFVCCWYPCCRPRPQDRQRRRRRRRGPPPSDEEENAASRVPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.17
3 0.2
4 0.21
5 0.22
6 0.22
7 0.22
8 0.21
9 0.22
10 0.19
11 0.16
12 0.14
13 0.1
14 0.09
15 0.08
16 0.09
17 0.08
18 0.07
19 0.06
20 0.07
21 0.07
22 0.08
23 0.08
24 0.07
25 0.08
26 0.08
27 0.1
28 0.1
29 0.13
30 0.13
31 0.13
32 0.14
33 0.13
34 0.15
35 0.14
36 0.16
37 0.12
38 0.13
39 0.12
40 0.14
41 0.14
42 0.12
43 0.11
44 0.09
45 0.1
46 0.1
47 0.09
48 0.08
49 0.07
50 0.07
51 0.07
52 0.06
53 0.06
54 0.04
55 0.04
56 0.03
57 0.03
58 0.03
59 0.03
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.04
67 0.04
68 0.07
69 0.13
70 0.22
71 0.29
72 0.34
73 0.43
74 0.51
75 0.6
76 0.69
77 0.74
78 0.77
79 0.82
80 0.88
81 0.91
82 0.94
83 0.95
84 0.95
85 0.95
86 0.95
87 0.96
88 0.96
89 0.95
90 0.93
91 0.9
92 0.86
93 0.82
94 0.72
95 0.64
96 0.57
97 0.48
98 0.39
99 0.31