Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

E2LX60

Protein Details
Accession E2LX60    Localization Confidence Low Confidence Score 6.3
NoLS Segment(s)
PositionSequenceProtein Nature
98-117ISHPKPFKCSIKPRSPKAVAHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, cyto_nucl 5.5, cyto 5, nucl 4, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036396  Cyt_P450_sf  
Gene Ontology GO:0020037  F:heme binding  
GO:0005506  F:iron ion binding  
GO:0004497  F:monooxygenase activity  
GO:0016705  F:oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen  
KEGG mpr:MPER_11860  -  
Amino Acid Sequences MDFNPDRFLANHDRQPEPDPRELCFGFGRRYASTFLGSAFKIETSRCVLSESICPGMHLADASVFVSCAMSLAVFDITKCVENGVAIEPVNDRTTGTISHPKPFKCSIKPRSPKAVALIQSEETAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.48
3 0.51
4 0.47
5 0.48
6 0.44
7 0.41
8 0.45
9 0.43
10 0.4
11 0.36
12 0.33
13 0.29
14 0.31
15 0.32
16 0.26
17 0.28
18 0.28
19 0.25
20 0.24
21 0.2
22 0.18
23 0.17
24 0.16
25 0.15
26 0.13
27 0.11
28 0.11
29 0.11
30 0.12
31 0.14
32 0.15
33 0.14
34 0.16
35 0.15
36 0.16
37 0.19
38 0.18
39 0.17
40 0.16
41 0.16
42 0.14
43 0.14
44 0.13
45 0.09
46 0.07
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.03
55 0.03
56 0.03
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.04
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.07
71 0.08
72 0.09
73 0.08
74 0.09
75 0.1
76 0.11
77 0.12
78 0.11
79 0.1
80 0.09
81 0.11
82 0.11
83 0.16
84 0.23
85 0.24
86 0.32
87 0.37
88 0.37
89 0.41
90 0.48
91 0.51
92 0.51
93 0.6
94 0.63
95 0.69
96 0.77
97 0.8
98 0.82
99 0.79
100 0.73
101 0.68
102 0.65
103 0.59
104 0.54
105 0.5
106 0.41