Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428PWH2

Protein Details
Accession A0A428PWH2    Localization Confidence Medium Confidence Score 14.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-39GNTSKPTAEERKERKRLQNRINQRARRQRLRDQNGTHHydrophilic
NLS Segment(s)
PositionSequence
13-29RKERKRLQNRINQRARR
Subcellular Location(s) nucl 24.5, cyto_nucl 15
Family & Domain DBs
Amino Acid Sequences MIGNTSKPTAEERKERKRLQNRINQRARRQRLRDQNGTHSQRGPYQVNRWRLDEGPALPEPSPKAPAPSLKYPPSSKPGLYHQFHLSSAQYSSAQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.76
3 0.81
4 0.83
5 0.86
6 0.86
7 0.86
8 0.86
9 0.87
10 0.9
11 0.87
12 0.87
13 0.87
14 0.87
15 0.86
16 0.82
17 0.81
18 0.82
19 0.82
20 0.8
21 0.74
22 0.74
23 0.74
24 0.72
25 0.64
26 0.55
27 0.48
28 0.42
29 0.42
30 0.36
31 0.29
32 0.33
33 0.38
34 0.43
35 0.44
36 0.43
37 0.4
38 0.38
39 0.37
40 0.32
41 0.25
42 0.22
43 0.2
44 0.2
45 0.18
46 0.19
47 0.18
48 0.17
49 0.19
50 0.15
51 0.18
52 0.19
53 0.26
54 0.3
55 0.36
56 0.41
57 0.41
58 0.47
59 0.47
60 0.49
61 0.48
62 0.46
63 0.4
64 0.38
65 0.43
66 0.47
67 0.46
68 0.46
69 0.46
70 0.44
71 0.43
72 0.42
73 0.34
74 0.27
75 0.25