Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428R1B0

Protein Details
Accession A0A428R1B0    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-41GGALKLKGSKVHKKKKKRDKKTDLEKNLDTBasic
NLS Segment(s)
PositionSequence
16-56KLKGSKVHKKKKKRDKKTDLEKNLDTGKREGPDPDRKKKNK
89-91KKK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MASDDYTAVGGGGALKLKGSKVHKKKKKRDKKTDLEKNLDTGKREGPDPDRKKKNKEVDEEQQPREEEEDDDRPQAQKTEAEKRHDEIKKKRLLKLAESSGSRPELLKTHKERVEELNTYLSRLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.07
3 0.08
4 0.09
5 0.16
6 0.23
7 0.33
8 0.43
9 0.55
10 0.64
11 0.75
12 0.85
13 0.9
14 0.93
15 0.94
16 0.94
17 0.94
18 0.95
19 0.95
20 0.95
21 0.93
22 0.89
23 0.78
24 0.71
25 0.67
26 0.59
27 0.5
28 0.41
29 0.36
30 0.3
31 0.29
32 0.29
33 0.29
34 0.37
35 0.43
36 0.51
37 0.57
38 0.61
39 0.68
40 0.74
41 0.77
42 0.74
43 0.73
44 0.71
45 0.69
46 0.74
47 0.72
48 0.64
49 0.57
50 0.5
51 0.42
52 0.36
53 0.28
54 0.18
55 0.16
56 0.19
57 0.17
58 0.18
59 0.18
60 0.17
61 0.17
62 0.17
63 0.14
64 0.14
65 0.18
66 0.28
67 0.33
68 0.37
69 0.39
70 0.4
71 0.48
72 0.49
73 0.53
74 0.52
75 0.56
76 0.6
77 0.63
78 0.66
79 0.63
80 0.62
81 0.6
82 0.59
83 0.56
84 0.52
85 0.49
86 0.46
87 0.42
88 0.39
89 0.33
90 0.25
91 0.21
92 0.22
93 0.25
94 0.33
95 0.36
96 0.44
97 0.47
98 0.48
99 0.49
100 0.5
101 0.53
102 0.46
103 0.42
104 0.41
105 0.38
106 0.37
107 0.35
108 0.28
109 0.21
110 0.19
111 0.23
112 0.2
113 0.23
114 0.28
115 0.35
116 0.36