Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428PN93

Protein Details
Accession A0A428PN93    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
36-62VSAKKHVPIVKKRTKRFERHQSDRFKCBasic
NLS Segment(s)
PositionSequence
37-54SAKKHVPIVKKRTKRFER
68-80RKPKGIDSRVRRR
Subcellular Location(s) nucl 18, cyto_nucl 12.833, mito_nucl 11.999, mito 4.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MRSQFDVCQKFASPDPHAGHYHSHPARRLTRSVKMVSAKKHVPIVKKRTKRFERHQSDRFKCVDPSWRKPKGIDSRVRRRFRGTIAMPSIGYGSNKKTRFLTPSGHKAFLVSNVNDVELLLMHNRTHAAEIAHNVSSRKRIDIIARAKQLGVKVTNAKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.39
2 0.41
3 0.42
4 0.42
5 0.41
6 0.4
7 0.37
8 0.43
9 0.39
10 0.41
11 0.41
12 0.47
13 0.53
14 0.53
15 0.57
16 0.53
17 0.57
18 0.58
19 0.56
20 0.55
21 0.55
22 0.56
23 0.54
24 0.55
25 0.49
26 0.46
27 0.5
28 0.48
29 0.49
30 0.53
31 0.58
32 0.61
33 0.68
34 0.73
35 0.77
36 0.82
37 0.83
38 0.84
39 0.84
40 0.84
41 0.84
42 0.85
43 0.85
44 0.8
45 0.76
46 0.68
47 0.59
48 0.5
49 0.44
50 0.46
51 0.43
52 0.48
53 0.52
54 0.54
55 0.53
56 0.53
57 0.59
58 0.6
59 0.6
60 0.6
61 0.6
62 0.65
63 0.74
64 0.77
65 0.69
66 0.63
67 0.57
68 0.51
69 0.51
70 0.42
71 0.39
72 0.37
73 0.36
74 0.31
75 0.28
76 0.26
77 0.17
78 0.16
79 0.11
80 0.13
81 0.19
82 0.2
83 0.22
84 0.23
85 0.25
86 0.29
87 0.31
88 0.35
89 0.34
90 0.44
91 0.46
92 0.45
93 0.42
94 0.38
95 0.35
96 0.33
97 0.31
98 0.21
99 0.2
100 0.19
101 0.19
102 0.18
103 0.17
104 0.12
105 0.07
106 0.08
107 0.06
108 0.07
109 0.07
110 0.08
111 0.09
112 0.09
113 0.1
114 0.11
115 0.11
116 0.12
117 0.15
118 0.18
119 0.19
120 0.2
121 0.2
122 0.2
123 0.25
124 0.24
125 0.24
126 0.23
127 0.25
128 0.3
129 0.38
130 0.45
131 0.48
132 0.51
133 0.49
134 0.48
135 0.47
136 0.43
137 0.4
138 0.33
139 0.3
140 0.32
141 0.37
142 0.43
143 0.41
144 0.41
145 0.37