Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428Q185

Protein Details
Accession A0A428Q185    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
58-77KYDSTKAKVKRSVQKLQKAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, pero 2
Family & Domain DBs
Amino Acid Sequences MANTAAHHAKSLLRIAGAAIHVMACPCPPTLINQWKGMWRTWQVGEFEVRFDLYEDTKYDSTKAKVKRSVQKLQKAVHRKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.17
4 0.15
5 0.12
6 0.08
7 0.07
8 0.07
9 0.08
10 0.07
11 0.05
12 0.06
13 0.06
14 0.07
15 0.07
16 0.11
17 0.2
18 0.28
19 0.31
20 0.33
21 0.34
22 0.37
23 0.39
24 0.35
25 0.3
26 0.25
27 0.25
28 0.22
29 0.24
30 0.21
31 0.2
32 0.22
33 0.18
34 0.16
35 0.14
36 0.13
37 0.1
38 0.1
39 0.1
40 0.09
41 0.1
42 0.11
43 0.15
44 0.16
45 0.16
46 0.17
47 0.2
48 0.23
49 0.29
50 0.35
51 0.39
52 0.47
53 0.56
54 0.64
55 0.68
56 0.75
57 0.77
58 0.8
59 0.79
60 0.78
61 0.79