Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428R7S1

Protein Details
Accession A0A428R7S1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-31IRTHHITSRKKLQRVRRAAQHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MSRTAGLFNCLIRTHHITSRKKLQRVRRAAQQLNVDWLLVRSGGSPGIMFAESHDEAGLTEWVATVQALRYKDFRCVAKPAPVEEVGKRTIGFDETESVAEFAKEMEGRGLGGWWRRAMGYENGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.35
3 0.44
4 0.47
5 0.54
6 0.64
7 0.67
8 0.69
9 0.72
10 0.76
11 0.77
12 0.8
13 0.78
14 0.77
15 0.78
16 0.75
17 0.73
18 0.68
19 0.59
20 0.54
21 0.48
22 0.37
23 0.27
24 0.23
25 0.18
26 0.11
27 0.1
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.05
34 0.07
35 0.07
36 0.06
37 0.06
38 0.11
39 0.11
40 0.11
41 0.11
42 0.09
43 0.09
44 0.1
45 0.1
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.03
53 0.04
54 0.07
55 0.08
56 0.1
57 0.13
58 0.14
59 0.19
60 0.23
61 0.24
62 0.24
63 0.29
64 0.3
65 0.34
66 0.35
67 0.32
68 0.32
69 0.32
70 0.31
71 0.27
72 0.28
73 0.22
74 0.21
75 0.19
76 0.16
77 0.15
78 0.14
79 0.14
80 0.11
81 0.13
82 0.13
83 0.14
84 0.13
85 0.13
86 0.12
87 0.1
88 0.09
89 0.07
90 0.09
91 0.08
92 0.08
93 0.09
94 0.09
95 0.1
96 0.1
97 0.11
98 0.12
99 0.17
100 0.2
101 0.19
102 0.2
103 0.2
104 0.22
105 0.25