Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NY80

Protein Details
Accession A0A428NY80    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MAPAAGGKKQKKKWSKGKVKDKAQHAVIHydrophilic
NLS Segment(s)
PositionSequence
6-22GGKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 11.5, cyto_nucl 9, mito 7, nucl 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAGGKKQKKKWSKGKVKDKAQHAVILDKTTSEKLYKDVQSYRLVTVATLVDRMKINGSLARQCIADLEEKGMIKPVITHSKMKIYTRAVGGTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.89
4 0.92
5 0.92
6 0.93
7 0.9
8 0.85
9 0.82
10 0.72
11 0.65
12 0.55
13 0.5
14 0.41
15 0.35
16 0.28
17 0.21
18 0.2
19 0.17
20 0.18
21 0.13
22 0.13
23 0.14
24 0.2
25 0.22
26 0.24
27 0.26
28 0.28
29 0.31
30 0.32
31 0.3
32 0.25
33 0.22
34 0.18
35 0.16
36 0.13
37 0.08
38 0.09
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.09
45 0.1
46 0.11
47 0.13
48 0.15
49 0.16
50 0.17
51 0.16
52 0.15
53 0.15
54 0.14
55 0.15
56 0.12
57 0.13
58 0.15
59 0.15
60 0.15
61 0.17
62 0.16
63 0.13
64 0.14
65 0.19
66 0.26
67 0.29
68 0.33
69 0.33
70 0.42
71 0.47
72 0.48
73 0.49
74 0.44
75 0.47
76 0.46