Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G7XZR3

Protein Details
Accession G7XZR3    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
219-239NRSGSKSSKSSKKPSTKTGSHHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 20, nucl 3, mito 3, mito_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008160  Collagen  
IPR016191  Ribonuclease/ribotoxin  
Gene Ontology GO:0003723  F:RNA binding  
GO:0004540  F:RNA nuclease activity  
Pfam View protein in Pfam  
PF01391  Collagen  
Amino Acid Sequences MLFSLKPTLFLALALTAVASPIANPTADEPSTLVARGRAKIKDVNCGGEILTKTDISNAIRESKNPSGGIYPKPFMNYDGFFGASNMQEYPLIPGGTYTDCAKKKLEGNGAPGKYRVITNGSNQYVGSVYHPTLTGNTFKKCNNIADSPTTTTTTTTTTRATTTATAKATTNDSGNSSGNSGNSGNSGNSGNSGNSGNSGNSGNSGNSGNSGNSGNSGNRSGSKSSKSSKKPSTKTGSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.06
4 0.06
5 0.06
6 0.04
7 0.04
8 0.06
9 0.07
10 0.07
11 0.08
12 0.1
13 0.15
14 0.16
15 0.16
16 0.15
17 0.16
18 0.17
19 0.17
20 0.15
21 0.15
22 0.19
23 0.22
24 0.27
25 0.27
26 0.3
27 0.35
28 0.36
29 0.41
30 0.4
31 0.4
32 0.35
33 0.34
34 0.3
35 0.28
36 0.27
37 0.2
38 0.19
39 0.16
40 0.15
41 0.16
42 0.19
43 0.15
44 0.18
45 0.17
46 0.22
47 0.22
48 0.24
49 0.29
50 0.31
51 0.33
52 0.3
53 0.29
54 0.28
55 0.31
56 0.36
57 0.33
58 0.31
59 0.28
60 0.29
61 0.29
62 0.26
63 0.26
64 0.2
65 0.18
66 0.18
67 0.18
68 0.16
69 0.15
70 0.15
71 0.11
72 0.11
73 0.09
74 0.08
75 0.07
76 0.07
77 0.1
78 0.11
79 0.1
80 0.09
81 0.09
82 0.1
83 0.11
84 0.12
85 0.11
86 0.15
87 0.17
88 0.19
89 0.19
90 0.21
91 0.25
92 0.3
93 0.36
94 0.31
95 0.37
96 0.43
97 0.43
98 0.4
99 0.36
100 0.31
101 0.24
102 0.21
103 0.16
104 0.12
105 0.13
106 0.16
107 0.23
108 0.23
109 0.23
110 0.22
111 0.21
112 0.17
113 0.16
114 0.14
115 0.09
116 0.08
117 0.08
118 0.09
119 0.08
120 0.09
121 0.1
122 0.14
123 0.16
124 0.18
125 0.2
126 0.21
127 0.25
128 0.26
129 0.28
130 0.27
131 0.27
132 0.28
133 0.3
134 0.32
135 0.3
136 0.29
137 0.28
138 0.23
139 0.21
140 0.19
141 0.18
142 0.17
143 0.16
144 0.16
145 0.15
146 0.16
147 0.16
148 0.17
149 0.16
150 0.18
151 0.2
152 0.2
153 0.2
154 0.2
155 0.21
156 0.22
157 0.21
158 0.19
159 0.15
160 0.16
161 0.17
162 0.18
163 0.17
164 0.15
165 0.15
166 0.14
167 0.15
168 0.13
169 0.11
170 0.12
171 0.12
172 0.11
173 0.11
174 0.12
175 0.1
176 0.11
177 0.12
178 0.11
179 0.12
180 0.13
181 0.11
182 0.12
183 0.13
184 0.11
185 0.12
186 0.13
187 0.11
188 0.12
189 0.13
190 0.11
191 0.12
192 0.13
193 0.11
194 0.12
195 0.13
196 0.11
197 0.12
198 0.13
199 0.11
200 0.12
201 0.14
202 0.14
203 0.16
204 0.18
205 0.19
206 0.22
207 0.26
208 0.29
209 0.32
210 0.36
211 0.4
212 0.47
213 0.55
214 0.6
215 0.67
216 0.73
217 0.78
218 0.79
219 0.83