Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7XPM4

Protein Details
Accession G7XPM4    Localization Confidence High Confidence Score 15.2
NoLS Segment(s)
PositionSequenceProtein Nature
96-117ATEPATKKKKRNDAEKNGPETPHydrophilic
NLS Segment(s)
PositionSequence
102-114KKKKRNDAEKNGP
123-153TAKHTKKGLTTNGDKKKGGRSKTAKESVKRE
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
Amino Acid Sequences MLYTDDSEEQEPTNGANLPAKPSSATEPAGESKPTSNTKTVDEAKSTDETGPRSQVPTSVDTAPKESVTESNVGEKREHEVTPATVEADKTGADDATEPATKKKKRNDAEKNGPETPPPFPTTAKHTKKGLTTNGDKKKGGRSKTAKESVKREPPTDGISSRTRSRTKVAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.13
3 0.17
4 0.18
5 0.21
6 0.22
7 0.22
8 0.2
9 0.21
10 0.25
11 0.24
12 0.25
13 0.21
14 0.23
15 0.26
16 0.27
17 0.26
18 0.22
19 0.2
20 0.25
21 0.29
22 0.29
23 0.3
24 0.3
25 0.32
26 0.38
27 0.41
28 0.37
29 0.35
30 0.33
31 0.32
32 0.32
33 0.3
34 0.25
35 0.22
36 0.22
37 0.22
38 0.24
39 0.21
40 0.21
41 0.2
42 0.21
43 0.21
44 0.2
45 0.21
46 0.21
47 0.23
48 0.22
49 0.24
50 0.22
51 0.2
52 0.18
53 0.15
54 0.13
55 0.12
56 0.13
57 0.11
58 0.18
59 0.2
60 0.21
61 0.2
62 0.2
63 0.21
64 0.22
65 0.21
66 0.15
67 0.14
68 0.14
69 0.15
70 0.14
71 0.12
72 0.09
73 0.09
74 0.08
75 0.07
76 0.07
77 0.06
78 0.06
79 0.05
80 0.04
81 0.05
82 0.06
83 0.08
84 0.09
85 0.09
86 0.14
87 0.23
88 0.28
89 0.34
90 0.42
91 0.5
92 0.56
93 0.67
94 0.73
95 0.76
96 0.82
97 0.83
98 0.81
99 0.73
100 0.66
101 0.56
102 0.48
103 0.4
104 0.32
105 0.26
106 0.22
107 0.21
108 0.22
109 0.29
110 0.38
111 0.41
112 0.43
113 0.44
114 0.47
115 0.51
116 0.55
117 0.55
118 0.52
119 0.55
120 0.6
121 0.66
122 0.67
123 0.63
124 0.59
125 0.62
126 0.61
127 0.57
128 0.57
129 0.56
130 0.6
131 0.7
132 0.77
133 0.74
134 0.74
135 0.76
136 0.76
137 0.77
138 0.73
139 0.64
140 0.59
141 0.55
142 0.53
143 0.51
144 0.43
145 0.38
146 0.39
147 0.42
148 0.44
149 0.48
150 0.47
151 0.45