Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NNE2

Protein Details
Accession A0A428NNE2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
34-57WTRTGVRRLCRGRKAKKKATVLALHydrophilic
NLS Segment(s)
PositionSequence
45-51GRKAKKK
Subcellular Location(s) mito 9, cyto 8, plas 3, extr 3, E.R. 2, vacu 2
Family & Domain DBs
Amino Acid Sequences MGAFIAAAKLADLFGKVILVVQEGKRIGVGLVAWTRTGVRRLCRGRKAKKKATVLALGYDAMMCWKCVLYYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.07
7 0.09
8 0.09
9 0.13
10 0.13
11 0.13
12 0.13
13 0.12
14 0.11
15 0.09
16 0.09
17 0.07
18 0.08
19 0.09
20 0.08
21 0.08
22 0.09
23 0.1
24 0.14
25 0.14
26 0.16
27 0.24
28 0.33
29 0.41
30 0.5
31 0.59
32 0.66
33 0.74
34 0.81
35 0.82
36 0.83
37 0.83
38 0.8
39 0.77
40 0.73
41 0.63
42 0.55
43 0.47
44 0.38
45 0.29
46 0.23
47 0.16
48 0.12
49 0.11
50 0.09
51 0.09
52 0.09