Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428P4Z0

Protein Details
Accession A0A428P4Z0    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
234-265VDRDERPRSQSRSRSRSRSRSRSRSRSRSRSPHydrophilic
NLS Segment(s)
PositionSequence
146-152RKLRRRG
240-265PRSQSRSRSRSRSRSRSRSRSRSRSP
Subcellular Location(s) nucl 14, cyto_nucl 14, cyto 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR005037  PRP38  
Gene Ontology GO:0071011  C:precatalytic spliceosome  
GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF03371  PRP38  
Amino Acid Sequences MSKNKDTVQADARRFLDERGSNATMAPNGLNPATIMEKAVKDRIVDSYFYKEQCFALNEADIVDRVVEHVSFIGGTYGVTQKPSPFLCLAFKLLELAPSDAVLHEYLHYGGDEFKYLRALACFYFRLTRQAKDVYEMLEPFLEDRRKLRRRGRAGVALTYMDEFVDDLLVKDRVCGTSLWKMPKRETLEDLEILEPRVSPLGDLEDLLEEDEAEGENGTREESGELSDRDEMDVDRDERPRSQSRSRSRSRSRSRSRSRSRSRSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.41
3 0.41
4 0.34
5 0.35
6 0.36
7 0.36
8 0.32
9 0.32
10 0.33
11 0.24
12 0.23
13 0.2
14 0.13
15 0.13
16 0.13
17 0.13
18 0.11
19 0.12
20 0.13
21 0.13
22 0.13
23 0.14
24 0.16
25 0.19
26 0.23
27 0.22
28 0.21
29 0.22
30 0.27
31 0.26
32 0.25
33 0.25
34 0.29
35 0.31
36 0.32
37 0.31
38 0.27
39 0.25
40 0.27
41 0.26
42 0.21
43 0.19
44 0.18
45 0.17
46 0.16
47 0.16
48 0.12
49 0.1
50 0.08
51 0.06
52 0.06
53 0.07
54 0.06
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.04
63 0.06
64 0.08
65 0.09
66 0.1
67 0.11
68 0.11
69 0.16
70 0.16
71 0.17
72 0.16
73 0.17
74 0.19
75 0.2
76 0.22
77 0.18
78 0.17
79 0.16
80 0.15
81 0.15
82 0.13
83 0.12
84 0.1
85 0.1
86 0.1
87 0.08
88 0.09
89 0.07
90 0.06
91 0.06
92 0.06
93 0.06
94 0.07
95 0.06
96 0.06
97 0.06
98 0.06
99 0.07
100 0.07
101 0.07
102 0.08
103 0.08
104 0.08
105 0.08
106 0.09
107 0.08
108 0.11
109 0.11
110 0.11
111 0.13
112 0.13
113 0.21
114 0.22
115 0.22
116 0.23
117 0.26
118 0.25
119 0.25
120 0.25
121 0.19
122 0.18
123 0.17
124 0.14
125 0.11
126 0.1
127 0.08
128 0.13
129 0.12
130 0.11
131 0.15
132 0.25
133 0.31
134 0.39
135 0.47
136 0.52
137 0.59
138 0.66
139 0.68
140 0.66
141 0.62
142 0.56
143 0.49
144 0.39
145 0.31
146 0.24
147 0.18
148 0.09
149 0.07
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.06
156 0.07
157 0.07
158 0.08
159 0.09
160 0.09
161 0.1
162 0.1
163 0.12
164 0.19
165 0.24
166 0.33
167 0.37
168 0.4
169 0.41
170 0.49
171 0.51
172 0.47
173 0.46
174 0.43
175 0.41
176 0.39
177 0.38
178 0.32
179 0.26
180 0.23
181 0.2
182 0.13
183 0.1
184 0.1
185 0.09
186 0.07
187 0.08
188 0.1
189 0.1
190 0.1
191 0.1
192 0.1
193 0.1
194 0.1
195 0.09
196 0.06
197 0.06
198 0.06
199 0.05
200 0.05
201 0.05
202 0.04
203 0.05
204 0.06
205 0.06
206 0.06
207 0.06
208 0.07
209 0.07
210 0.09
211 0.13
212 0.13
213 0.15
214 0.17
215 0.17
216 0.17
217 0.17
218 0.15
219 0.14
220 0.19
221 0.19
222 0.21
223 0.25
224 0.27
225 0.29
226 0.36
227 0.41
228 0.44
229 0.52
230 0.58
231 0.65
232 0.73
233 0.79
234 0.83
235 0.85
236 0.89
237 0.9
238 0.91
239 0.91
240 0.92
241 0.94
242 0.94
243 0.95
244 0.95
245 0.95