Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428Q8M2

Protein Details
Accession A0A428Q8M2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
15-40LNPIACGHCRQRKRKVRHNDEQLDLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Amino Acid Sequences MTDSDAAGGEAERLLNPIACGHCRQRKRKVRHNDEQLDLNSANDDYFSVTGDCKPHCLQCSHDPSNCHYPEQNKRGIPIGFITRLEARLAETEEALFQVLQSLENDPQNAQRSLKPPSQRKVDRIREWDTLPLKSLDDIKTWFQSKSEPGNSMTAPLRVAQMELNLPIQRTVVTPELSASITDPQSSERTTSPLQDMGSESLLDASWDGSSDTTMSKARSLERRHPNMYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.1
4 0.13
5 0.16
6 0.18
7 0.23
8 0.31
9 0.4
10 0.48
11 0.57
12 0.64
13 0.72
14 0.79
15 0.85
16 0.87
17 0.88
18 0.89
19 0.91
20 0.88
21 0.81
22 0.77
23 0.68
24 0.62
25 0.51
26 0.4
27 0.3
28 0.23
29 0.19
30 0.12
31 0.11
32 0.07
33 0.07
34 0.08
35 0.08
36 0.09
37 0.12
38 0.15
39 0.15
40 0.18
41 0.2
42 0.23
43 0.26
44 0.27
45 0.3
46 0.36
47 0.46
48 0.46
49 0.48
50 0.46
51 0.48
52 0.56
53 0.51
54 0.44
55 0.37
56 0.4
57 0.47
58 0.5
59 0.52
60 0.43
61 0.43
62 0.46
63 0.43
64 0.36
65 0.28
66 0.27
67 0.21
68 0.21
69 0.22
70 0.17
71 0.18
72 0.17
73 0.14
74 0.11
75 0.11
76 0.12
77 0.11
78 0.09
79 0.09
80 0.09
81 0.09
82 0.08
83 0.06
84 0.04
85 0.05
86 0.05
87 0.06
88 0.06
89 0.08
90 0.09
91 0.1
92 0.11
93 0.1
94 0.13
95 0.16
96 0.17
97 0.17
98 0.19
99 0.21
100 0.25
101 0.3
102 0.34
103 0.37
104 0.42
105 0.51
106 0.51
107 0.55
108 0.61
109 0.66
110 0.65
111 0.64
112 0.63
113 0.56
114 0.53
115 0.53
116 0.45
117 0.36
118 0.31
119 0.25
120 0.2
121 0.18
122 0.21
123 0.15
124 0.15
125 0.16
126 0.17
127 0.2
128 0.22
129 0.21
130 0.18
131 0.19
132 0.22
133 0.28
134 0.28
135 0.26
136 0.27
137 0.29
138 0.29
139 0.29
140 0.26
141 0.19
142 0.17
143 0.15
144 0.14
145 0.12
146 0.12
147 0.09
148 0.1
149 0.1
150 0.11
151 0.13
152 0.13
153 0.13
154 0.12
155 0.12
156 0.11
157 0.11
158 0.13
159 0.14
160 0.14
161 0.14
162 0.14
163 0.16
164 0.15
165 0.15
166 0.12
167 0.13
168 0.13
169 0.13
170 0.13
171 0.14
172 0.16
173 0.17
174 0.18
175 0.15
176 0.2
177 0.21
178 0.24
179 0.24
180 0.25
181 0.24
182 0.23
183 0.24
184 0.22
185 0.21
186 0.18
187 0.15
188 0.13
189 0.12
190 0.11
191 0.08
192 0.07
193 0.06
194 0.06
195 0.07
196 0.06
197 0.07
198 0.08
199 0.08
200 0.1
201 0.13
202 0.14
203 0.17
204 0.2
205 0.26
206 0.34
207 0.42
208 0.49
209 0.57
210 0.65