Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NXB6

Protein Details
Accession A0A428NXB6    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
106-132SILISPRKRPPVRKAKSPKKRAKESSGHydrophilic
NLS Segment(s)
PositionSequence
111-131PRKRPPVRKAKSPKKRAKESS
Subcellular Location(s) nucl 26.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MNDQSEPPTKKRRTEAPITEEPIQLKEDDPILSKDNEPIPLKDEEEGLEELFLLLMRIHKLTRRNQELKQILDETLAETSKLRTHLDYLRVVHYLKTENPMFKPISILISPRKRPPVRKAKSPKKRAKESSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.73
3 0.71
4 0.73
5 0.71
6 0.67
7 0.59
8 0.52
9 0.43
10 0.36
11 0.28
12 0.2
13 0.16
14 0.15
15 0.14
16 0.15
17 0.16
18 0.17
19 0.18
20 0.18
21 0.21
22 0.21
23 0.26
24 0.26
25 0.24
26 0.25
27 0.25
28 0.25
29 0.22
30 0.2
31 0.15
32 0.15
33 0.15
34 0.12
35 0.1
36 0.09
37 0.08
38 0.07
39 0.06
40 0.04
41 0.03
42 0.04
43 0.05
44 0.06
45 0.07
46 0.11
47 0.17
48 0.24
49 0.33
50 0.41
51 0.45
52 0.47
53 0.56
54 0.56
55 0.52
56 0.47
57 0.39
58 0.3
59 0.26
60 0.24
61 0.15
62 0.12
63 0.1
64 0.08
65 0.07
66 0.08
67 0.1
68 0.11
69 0.12
70 0.11
71 0.15
72 0.19
73 0.23
74 0.27
75 0.26
76 0.27
77 0.28
78 0.27
79 0.25
80 0.22
81 0.21
82 0.18
83 0.22
84 0.23
85 0.25
86 0.26
87 0.3
88 0.29
89 0.26
90 0.27
91 0.22
92 0.23
93 0.21
94 0.23
95 0.28
96 0.37
97 0.41
98 0.46
99 0.55
100 0.58
101 0.65
102 0.72
103 0.74
104 0.72
105 0.79
106 0.84
107 0.84
108 0.89
109 0.91
110 0.91
111 0.9
112 0.94