Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NUM3

Protein Details
Accession A0A428NUM3    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
58-87SYGTYGAKPKPKPKPKPAPKKPAPKKYTNYHydrophilic
159-193SYGTYGAKPKPKPKPKPAPKKPAPKKPAPKKYTTYHydrophilic
NLS Segment(s)
PositionSequence
65-83KPKPKPKPKPAPKKPAPKK
166-189KPKPKPKPKPAPKKPAPKKPAPKK
Subcellular Location(s) extr 16, cyto 3, E.R. 3, mito 2, golg 2
Family & Domain DBs
Amino Acid Sequences MKLSAITLLALAAGAIAAPAPAPEAEVAPQEEKREASPGYASYGDYKGAGENLPSYPSYGTYGAKPKPKPKPKPAPKKPAPKKYTNYGSYNYKKYGSYGSYKREEVEKREAEPEVEVEVEKREAEPEVEVDVEKREASPGYASYGDYKGAGENLPSYPSYGTYGAKPKPKPKPKPAPKKPAPKKPAPKKYTTYGSYSYKKYGSYGAYKRPTDWIKSWF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.04
9 0.05
10 0.06
11 0.07
12 0.08
13 0.11
14 0.14
15 0.16
16 0.18
17 0.19
18 0.2
19 0.21
20 0.21
21 0.22
22 0.2
23 0.19
24 0.2
25 0.19
26 0.2
27 0.2
28 0.2
29 0.19
30 0.19
31 0.18
32 0.15
33 0.15
34 0.12
35 0.12
36 0.12
37 0.09
38 0.1
39 0.1
40 0.12
41 0.12
42 0.12
43 0.11
44 0.12
45 0.14
46 0.14
47 0.14
48 0.17
49 0.24
50 0.28
51 0.35
52 0.4
53 0.46
54 0.55
55 0.65
56 0.71
57 0.74
58 0.81
59 0.84
60 0.9
61 0.92
62 0.92
63 0.91
64 0.92
65 0.91
66 0.91
67 0.86
68 0.84
69 0.78
70 0.76
71 0.76
72 0.7
73 0.63
74 0.57
75 0.6
76 0.56
77 0.55
78 0.48
79 0.4
80 0.35
81 0.32
82 0.32
83 0.25
84 0.27
85 0.29
86 0.33
87 0.34
88 0.35
89 0.34
90 0.36
91 0.36
92 0.34
93 0.38
94 0.34
95 0.32
96 0.33
97 0.33
98 0.27
99 0.24
100 0.19
101 0.11
102 0.1
103 0.08
104 0.06
105 0.07
106 0.07
107 0.07
108 0.06
109 0.06
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.07
117 0.07
118 0.08
119 0.08
120 0.07
121 0.07
122 0.07
123 0.07
124 0.08
125 0.09
126 0.09
127 0.12
128 0.13
129 0.14
130 0.16
131 0.17
132 0.16
133 0.15
134 0.15
135 0.12
136 0.12
137 0.12
138 0.09
139 0.1
140 0.1
141 0.12
142 0.12
143 0.12
144 0.11
145 0.12
146 0.14
147 0.14
148 0.14
149 0.17
150 0.24
151 0.28
152 0.35
153 0.4
154 0.46
155 0.55
156 0.65
157 0.71
158 0.74
159 0.81
160 0.84
161 0.9
162 0.92
163 0.92
164 0.91
165 0.92
166 0.92
167 0.91
168 0.89
169 0.88
170 0.89
171 0.89
172 0.91
173 0.86
174 0.84
175 0.78
176 0.78
177 0.76
178 0.69
179 0.63
180 0.59
181 0.61
182 0.59
183 0.57
184 0.53
185 0.46
186 0.43
187 0.39
188 0.38
189 0.35
190 0.39
191 0.43
192 0.49
193 0.55
194 0.56
195 0.56
196 0.6
197 0.59
198 0.56