Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428ND55

Protein Details
Accession A0A428ND55    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
24-56HGARSHAMREHWRRRRHKKDLAKRQRESQPQHABasic
NLS Segment(s)
PositionSequence
32-48REHWRRRRHKKDLAKRQ
Subcellular Location(s) nucl 14, mito 8, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR021858  Fun_TF  
Pfam View protein in Pfam  
PF11951  Fungal_trans_2  
Amino Acid Sequences MTPPNTQKPSPPPKEYAFVTPHQHGARSHAMREHWRRRRHKKDLAKRQRESQPQHALLPTPSTSEATDSQPSTETTDTHPDSTVLAGGGMFDPSMFETDMDSMMNGVPGQAMSGMNLALGSARLDPFDQFPVQLTTQHHRLLHHWLSTYATMMFDDVHGQAFNPMRDVWCPLDLSNAASFNAIMAHSAAHLARMQGLRQSKEALKFKAEAVRIVQVWMEDPERALSDDVLAAVLRLLTYERYWGTEAEWHVHYNGLSNLIQARGGIEALQSNWRLELTTFLQDHRPIPDFHNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.63
3 0.6
4 0.54
5 0.51
6 0.51
7 0.47
8 0.49
9 0.44
10 0.45
11 0.37
12 0.38
13 0.43
14 0.4
15 0.4
16 0.38
17 0.42
18 0.49
19 0.59
20 0.63
21 0.62
22 0.7
23 0.78
24 0.84
25 0.91
26 0.91
27 0.91
28 0.91
29 0.93
30 0.94
31 0.95
32 0.94
33 0.88
34 0.87
35 0.86
36 0.84
37 0.81
38 0.79
39 0.78
40 0.7
41 0.68
42 0.6
43 0.52
44 0.43
45 0.39
46 0.3
47 0.22
48 0.2
49 0.18
50 0.17
51 0.18
52 0.2
53 0.2
54 0.23
55 0.21
56 0.21
57 0.21
58 0.21
59 0.21
60 0.2
61 0.17
62 0.17
63 0.24
64 0.25
65 0.25
66 0.24
67 0.21
68 0.21
69 0.2
70 0.17
71 0.09
72 0.07
73 0.06
74 0.06
75 0.06
76 0.05
77 0.04
78 0.04
79 0.04
80 0.04
81 0.06
82 0.06
83 0.06
84 0.06
85 0.07
86 0.08
87 0.07
88 0.07
89 0.06
90 0.06
91 0.06
92 0.05
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.04
99 0.04
100 0.05
101 0.05
102 0.04
103 0.04
104 0.04
105 0.03
106 0.04
107 0.04
108 0.04
109 0.05
110 0.05
111 0.06
112 0.07
113 0.08
114 0.1
115 0.1
116 0.09
117 0.1
118 0.12
119 0.12
120 0.16
121 0.17
122 0.18
123 0.22
124 0.25
125 0.25
126 0.23
127 0.24
128 0.29
129 0.29
130 0.27
131 0.24
132 0.21
133 0.21
134 0.2
135 0.2
136 0.12
137 0.09
138 0.07
139 0.07
140 0.06
141 0.05
142 0.06
143 0.05
144 0.06
145 0.05
146 0.06
147 0.09
148 0.11
149 0.1
150 0.11
151 0.11
152 0.11
153 0.11
154 0.15
155 0.13
156 0.12
157 0.13
158 0.12
159 0.14
160 0.14
161 0.15
162 0.14
163 0.13
164 0.11
165 0.11
166 0.11
167 0.08
168 0.08
169 0.06
170 0.05
171 0.05
172 0.04
173 0.04
174 0.06
175 0.05
176 0.06
177 0.06
178 0.06
179 0.1
180 0.11
181 0.11
182 0.15
183 0.2
184 0.21
185 0.21
186 0.25
187 0.25
188 0.33
189 0.38
190 0.36
191 0.34
192 0.34
193 0.35
194 0.37
195 0.34
196 0.28
197 0.25
198 0.26
199 0.23
200 0.23
201 0.21
202 0.14
203 0.15
204 0.15
205 0.14
206 0.1
207 0.1
208 0.11
209 0.11
210 0.12
211 0.12
212 0.1
213 0.09
214 0.09
215 0.09
216 0.08
217 0.07
218 0.05
219 0.05
220 0.05
221 0.04
222 0.04
223 0.05
224 0.06
225 0.07
226 0.11
227 0.11
228 0.14
229 0.15
230 0.15
231 0.16
232 0.2
233 0.21
234 0.21
235 0.22
236 0.21
237 0.2
238 0.21
239 0.2
240 0.18
241 0.17
242 0.17
243 0.16
244 0.16
245 0.17
246 0.16
247 0.16
248 0.13
249 0.13
250 0.1
251 0.1
252 0.09
253 0.08
254 0.09
255 0.11
256 0.16
257 0.17
258 0.16
259 0.17
260 0.17
261 0.17
262 0.15
263 0.19
264 0.18
265 0.24
266 0.25
267 0.26
268 0.32
269 0.33
270 0.35
271 0.36
272 0.35
273 0.29