Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NG78

Protein Details
Accession A0A428NG78    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
28-54ENNYGPGRIVRRRRNNRAARRNHPASHHydrophilic
NLS Segment(s)
PositionSequence
37-48VRRRRNNRAARR
Subcellular Location(s) nucl 12, mito 8, extr 3, cyto 2, plas 2
Family & Domain DBs
Amino Acid Sequences MAAFAYRDASTYAPVIPSPLNPTNHGPENNYGPGRIVRRRRNNRAARRNHPASHTLTQRLLRVKAAEAWRGHVLSAQVAQYESAAAAALAKGPKGKNCYPPLRMSFSISDAHRIASGLRLPDLSCLKTRRMLLAMGLMGVLPALKVRDMLRQAGPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.14
4 0.15
5 0.21
6 0.26
7 0.27
8 0.3
9 0.34
10 0.38
11 0.43
12 0.43
13 0.39
14 0.36
15 0.39
16 0.41
17 0.37
18 0.32
19 0.27
20 0.3
21 0.33
22 0.38
23 0.42
24 0.47
25 0.58
26 0.68
27 0.76
28 0.82
29 0.87
30 0.9
31 0.9
32 0.9
33 0.86
34 0.86
35 0.82
36 0.75
37 0.67
38 0.61
39 0.57
40 0.53
41 0.49
42 0.42
43 0.39
44 0.38
45 0.38
46 0.37
47 0.32
48 0.27
49 0.24
50 0.22
51 0.24
52 0.25
53 0.26
54 0.23
55 0.24
56 0.24
57 0.23
58 0.22
59 0.18
60 0.15
61 0.11
62 0.11
63 0.09
64 0.07
65 0.07
66 0.07
67 0.06
68 0.05
69 0.05
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.04
76 0.05
77 0.05
78 0.08
79 0.09
80 0.13
81 0.19
82 0.23
83 0.3
84 0.38
85 0.45
86 0.46
87 0.52
88 0.52
89 0.53
90 0.5
91 0.45
92 0.38
93 0.34
94 0.35
95 0.28
96 0.29
97 0.22
98 0.22
99 0.18
100 0.17
101 0.15
102 0.14
103 0.16
104 0.13
105 0.13
106 0.13
107 0.13
108 0.18
109 0.21
110 0.2
111 0.23
112 0.25
113 0.27
114 0.32
115 0.33
116 0.32
117 0.31
118 0.29
119 0.25
120 0.27
121 0.24
122 0.19
123 0.17
124 0.13
125 0.1
126 0.09
127 0.08
128 0.03
129 0.04
130 0.05
131 0.06
132 0.08
133 0.1
134 0.18
135 0.22
136 0.26