Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NC66

Protein Details
Accession A0A428NC66    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
454-485KFVNGGQKKTPPKAPPPRRRGKMKAVEKPPADBasic
NLS Segment(s)
PositionSequence
434-481RPKKPLPAVPKHRHGVPFAQKFVNGGQKKTPPKAPPPRRRGKMKAVEK
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR016024  ARM-type_fold  
IPR030125  SPIN90/Ldb17  
IPR018556  SPIN90/Ldb17_LRD  
Pfam View protein in Pfam  
PF09431  SPIN90_LRD  
Amino Acid Sequences MADIEDVPLSPEDEEQLWTELGKCVSSKCESHETIDDTLRTWVELTTRLRDHFCESQDEIITCAQMLLASDLFQANKEYVRNQIIYSLLQEDEIGPLHAIACFLLLDGCQDDTMFPRMVGEACFPRLLELINGRRDEDPRLHRLLLQLMYEMSRMERLRIDDLQVVDDGFVHYLFQLIEEVSDDVHDPYHYPTIRVLLVLNEQYMLASTDAANDPSSPLTNRIVKCLSLHGPFFRTFGENIILLLNRETETSLQLLILKLLYLLFTNKATYEYFYTNDLRVLLDVIIRNLMDLPDEKMSLRHTYLRVLYPLLAHTQLSQPPHYKQDEILRVLNILRGSHNVHFAPADETTLRLVDRVSKVKWIEEVESPTQGSGEAEVARRFLGISLSRSDTASSISVSDVAAVKEKPGVQTPSRAGEEADADGSEEGITMASRPKKPLPAVPKHRHGVPFAQKFVNGGQKKTPPKAPPPRRRGKMKAVEKPPADPVTEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.14
3 0.16
4 0.15
5 0.15
6 0.16
7 0.17
8 0.17
9 0.17
10 0.16
11 0.16
12 0.21
13 0.25
14 0.26
15 0.28
16 0.36
17 0.37
18 0.41
19 0.45
20 0.43
21 0.43
22 0.45
23 0.4
24 0.32
25 0.33
26 0.28
27 0.23
28 0.19
29 0.16
30 0.14
31 0.21
32 0.23
33 0.28
34 0.32
35 0.34
36 0.36
37 0.37
38 0.41
39 0.41
40 0.39
41 0.38
42 0.36
43 0.38
44 0.39
45 0.37
46 0.32
47 0.26
48 0.24
49 0.17
50 0.15
51 0.1
52 0.07
53 0.08
54 0.08
55 0.08
56 0.08
57 0.09
58 0.1
59 0.11
60 0.11
61 0.12
62 0.11
63 0.13
64 0.15
65 0.16
66 0.2
67 0.25
68 0.26
69 0.25
70 0.26
71 0.25
72 0.24
73 0.24
74 0.21
75 0.16
76 0.15
77 0.15
78 0.12
79 0.11
80 0.11
81 0.1
82 0.07
83 0.07
84 0.08
85 0.08
86 0.07
87 0.06
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.06
97 0.07
98 0.07
99 0.09
100 0.13
101 0.12
102 0.11
103 0.11
104 0.12
105 0.13
106 0.14
107 0.15
108 0.14
109 0.16
110 0.16
111 0.16
112 0.16
113 0.16
114 0.15
115 0.14
116 0.19
117 0.23
118 0.28
119 0.29
120 0.3
121 0.32
122 0.33
123 0.34
124 0.35
125 0.34
126 0.34
127 0.38
128 0.37
129 0.36
130 0.37
131 0.38
132 0.32
133 0.26
134 0.21
135 0.17
136 0.17
137 0.16
138 0.14
139 0.09
140 0.12
141 0.12
142 0.13
143 0.15
144 0.17
145 0.21
146 0.22
147 0.24
148 0.22
149 0.22
150 0.22
151 0.19
152 0.17
153 0.12
154 0.11
155 0.09
156 0.06
157 0.06
158 0.05
159 0.04
160 0.05
161 0.05
162 0.05
163 0.05
164 0.05
165 0.05
166 0.06
167 0.06
168 0.05
169 0.06
170 0.06
171 0.05
172 0.06
173 0.06
174 0.06
175 0.08
176 0.14
177 0.14
178 0.14
179 0.15
180 0.17
181 0.17
182 0.16
183 0.15
184 0.1
185 0.12
186 0.12
187 0.11
188 0.09
189 0.09
190 0.08
191 0.08
192 0.08
193 0.05
194 0.05
195 0.05
196 0.07
197 0.07
198 0.08
199 0.08
200 0.07
201 0.08
202 0.08
203 0.09
204 0.08
205 0.1
206 0.13
207 0.19
208 0.19
209 0.23
210 0.23
211 0.23
212 0.23
213 0.24
214 0.24
215 0.2
216 0.21
217 0.19
218 0.2
219 0.2
220 0.2
221 0.17
222 0.15
223 0.13
224 0.13
225 0.13
226 0.1
227 0.1
228 0.1
229 0.1
230 0.08
231 0.08
232 0.07
233 0.06
234 0.06
235 0.06
236 0.06
237 0.07
238 0.07
239 0.07
240 0.06
241 0.07
242 0.07
243 0.07
244 0.06
245 0.05
246 0.05
247 0.04
248 0.05
249 0.04
250 0.05
251 0.06
252 0.06
253 0.07
254 0.07
255 0.09
256 0.09
257 0.1
258 0.12
259 0.12
260 0.13
261 0.16
262 0.17
263 0.16
264 0.16
265 0.15
266 0.12
267 0.11
268 0.11
269 0.08
270 0.08
271 0.08
272 0.08
273 0.08
274 0.08
275 0.08
276 0.07
277 0.07
278 0.06
279 0.06
280 0.08
281 0.09
282 0.09
283 0.09
284 0.1
285 0.13
286 0.14
287 0.15
288 0.18
289 0.17
290 0.21
291 0.23
292 0.24
293 0.23
294 0.21
295 0.2
296 0.17
297 0.17
298 0.15
299 0.13
300 0.11
301 0.11
302 0.13
303 0.16
304 0.17
305 0.2
306 0.22
307 0.23
308 0.29
309 0.3
310 0.28
311 0.28
312 0.35
313 0.38
314 0.38
315 0.38
316 0.32
317 0.31
318 0.3
319 0.29
320 0.21
321 0.15
322 0.13
323 0.13
324 0.17
325 0.17
326 0.21
327 0.19
328 0.19
329 0.18
330 0.18
331 0.18
332 0.14
333 0.15
334 0.11
335 0.11
336 0.11
337 0.12
338 0.11
339 0.09
340 0.09
341 0.14
342 0.19
343 0.23
344 0.23
345 0.28
346 0.29
347 0.31
348 0.34
349 0.3
350 0.28
351 0.27
352 0.32
353 0.28
354 0.29
355 0.27
356 0.24
357 0.21
358 0.18
359 0.14
360 0.09
361 0.09
362 0.09
363 0.12
364 0.13
365 0.13
366 0.13
367 0.13
368 0.12
369 0.1
370 0.13
371 0.14
372 0.16
373 0.19
374 0.23
375 0.23
376 0.24
377 0.24
378 0.19
379 0.18
380 0.17
381 0.14
382 0.11
383 0.1
384 0.11
385 0.1
386 0.11
387 0.1
388 0.1
389 0.13
390 0.12
391 0.13
392 0.15
393 0.17
394 0.18
395 0.22
396 0.28
397 0.27
398 0.34
399 0.37
400 0.4
401 0.41
402 0.39
403 0.33
404 0.29
405 0.29
406 0.23
407 0.2
408 0.13
409 0.12
410 0.11
411 0.11
412 0.09
413 0.07
414 0.06
415 0.05
416 0.05
417 0.05
418 0.12
419 0.19
420 0.22
421 0.28
422 0.33
423 0.41
424 0.45
425 0.53
426 0.57
427 0.61
428 0.69
429 0.74
430 0.78
431 0.74
432 0.77
433 0.71
434 0.65
435 0.64
436 0.63
437 0.62
438 0.58
439 0.56
440 0.5
441 0.48
442 0.49
443 0.49
444 0.41
445 0.37
446 0.4
447 0.46
448 0.55
449 0.6
450 0.63
451 0.61
452 0.69
453 0.77
454 0.8
455 0.82
456 0.85
457 0.89
458 0.9
459 0.92
460 0.9
461 0.89
462 0.89
463 0.89
464 0.88
465 0.86
466 0.87
467 0.79
468 0.74
469 0.71
470 0.63