Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428R1X1

Protein Details
Accession A0A428R1X1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
34-54QQPRHQPHRHRAPTPKKPRIDBasic
NLS Segment(s)
PositionSequence
41-53HRHRAPTPKKPRI
Subcellular Location(s) mito 17, nucl 9.5, cyto_nucl 5.5
Family & Domain DBs
Amino Acid Sequences MMPSKSIARIVQTSARYAFQSTRRTISSTSSHIQQPRHQPHRHRAPTPKKPRIDEAGFRRAAKAFLAEHERFFQALPWYKCWFYTFTDTVVYIPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.27
4 0.27
5 0.29
6 0.29
7 0.35
8 0.35
9 0.37
10 0.37
11 0.38
12 0.37
13 0.37
14 0.34
15 0.32
16 0.31
17 0.3
18 0.33
19 0.35
20 0.37
21 0.38
22 0.44
23 0.49
24 0.56
25 0.58
26 0.6
27 0.66
28 0.74
29 0.74
30 0.7
31 0.7
32 0.72
33 0.78
34 0.82
35 0.8
36 0.74
37 0.7
38 0.68
39 0.65
40 0.59
41 0.56
42 0.52
43 0.52
44 0.5
45 0.47
46 0.44
47 0.37
48 0.33
49 0.25
50 0.21
51 0.13
52 0.15
53 0.22
54 0.22
55 0.23
56 0.24
57 0.25
58 0.22
59 0.22
60 0.21
61 0.21
62 0.29
63 0.3
64 0.33
65 0.36
66 0.37
67 0.38
68 0.37
69 0.32
70 0.28
71 0.33
72 0.3
73 0.28
74 0.3
75 0.29
76 0.28