Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428Q3W3

Protein Details
Accession A0A428Q3W3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
6-28LPSPTSKPPKKLTPSPQFRPPPSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008389  ATPase_V0-cplx_e1/e2_su  
Gene Ontology GO:0033179  C:proton-transporting V-type ATPase, V0 domain  
GO:0046961  F:proton-transporting ATPase activity, rotational mechanism  
Pfam View protein in Pfam  
PF05493  ATP_synt_H  
Amino Acid Sequences MDNSSLPSPTSKPPKKLTPSPQFRPPPSNRNRPNEALLPAGSSSTRLSTKKHKPANMAQGYAVFIGLVVIAALCVASWFLAPKGENQVLWRSSLILAIVSCYLMWAITFMAQLHPLIAPRRTGIREEYLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.69
3 0.76
4 0.78
5 0.78
6 0.8
7 0.79
8 0.82
9 0.8
10 0.77
11 0.77
12 0.73
13 0.72
14 0.72
15 0.76
16 0.75
17 0.74
18 0.76
19 0.7
20 0.68
21 0.61
22 0.54
23 0.46
24 0.37
25 0.3
26 0.24
27 0.2
28 0.15
29 0.12
30 0.11
31 0.11
32 0.14
33 0.14
34 0.18
35 0.27
36 0.37
37 0.45
38 0.52
39 0.53
40 0.55
41 0.62
42 0.69
43 0.63
44 0.54
45 0.44
46 0.38
47 0.35
48 0.28
49 0.21
50 0.09
51 0.05
52 0.04
53 0.04
54 0.03
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.01
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.04
67 0.06
68 0.07
69 0.08
70 0.15
71 0.16
72 0.16
73 0.18
74 0.23
75 0.22
76 0.23
77 0.21
78 0.16
79 0.16
80 0.16
81 0.14
82 0.09
83 0.08
84 0.08
85 0.08
86 0.07
87 0.06
88 0.06
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.05
95 0.07
96 0.07
97 0.08
98 0.09
99 0.1
100 0.1
101 0.1
102 0.13
103 0.16
104 0.18
105 0.18
106 0.2
107 0.26
108 0.28
109 0.3
110 0.32