Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NB46

Protein Details
Accession A0A428NB46    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
104-130TDRPHSHPTPQPDRRTPRRKPTRARVTBasic
NLS Segment(s)
PositionSequence
117-127RRTPRRKPTRA
Subcellular Location(s) cyto 10.5, cyto_nucl 7.5, mito 4, extr 4, nucl 3.5, plas 2, pero 2
Family & Domain DBs
Amino Acid Sequences MLKVFDKCLDSALADEGIAVRKQAHFEHTTCLVRCRCFLLLLYPAAVAPEFADCVELSGLLTLLDVIAALSDSVCLGNCALTRHQMILLDLLVHVPSAHSFRPTDRPHSHPTPQPDRRTPRRKPTRARVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.1
4 0.12
5 0.11
6 0.11
7 0.1
8 0.11
9 0.14
10 0.15
11 0.2
12 0.21
13 0.22
14 0.27
15 0.31
16 0.35
17 0.33
18 0.39
19 0.36
20 0.34
21 0.34
22 0.33
23 0.28
24 0.24
25 0.24
26 0.21
27 0.21
28 0.2
29 0.19
30 0.15
31 0.14
32 0.13
33 0.12
34 0.08
35 0.05
36 0.05
37 0.04
38 0.04
39 0.05
40 0.05
41 0.06
42 0.06
43 0.05
44 0.05
45 0.04
46 0.04
47 0.03
48 0.03
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.03
61 0.03
62 0.03
63 0.03
64 0.05
65 0.06
66 0.08
67 0.09
68 0.12
69 0.12
70 0.13
71 0.14
72 0.13
73 0.13
74 0.12
75 0.11
76 0.09
77 0.08
78 0.07
79 0.07
80 0.06
81 0.05
82 0.04
83 0.06
84 0.08
85 0.09
86 0.11
87 0.12
88 0.16
89 0.26
90 0.3
91 0.38
92 0.41
93 0.46
94 0.52
95 0.58
96 0.61
97 0.58
98 0.64
99 0.66
100 0.69
101 0.72
102 0.74
103 0.77
104 0.81
105 0.85
106 0.86
107 0.86
108 0.88
109 0.9
110 0.91