Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NR25

Protein Details
Accession A0A428NR25    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
51-73GYCGSRTGRARRRTGRHMRTTRVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 13, mito 6, vacu 5, extr 3, cyto_mito 3, mito_nucl 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGGIMSCIRSVFQTIGDAIMAVISGIGNIIHALISAIVRFCGIIVSFLTCGYCGSRTGRARRRTGRHMRTTRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.11
5 0.08
6 0.07
7 0.06
8 0.04
9 0.03
10 0.02
11 0.02
12 0.02
13 0.02
14 0.02
15 0.02
16 0.03
17 0.02
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.04
29 0.04
30 0.05
31 0.05
32 0.06
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.08
39 0.09
40 0.09
41 0.12
42 0.21
43 0.28
44 0.39
45 0.47
46 0.54
47 0.63
48 0.71
49 0.76
50 0.79
51 0.83
52 0.83
53 0.85