Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NUY9

Protein Details
Accession A0A428NUY9    Localization Confidence High Confidence Score 15.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSTPISRKRRRLIDDDPKFRAHydrophilic
164-195CHEREHGFNKRQSKKREKRYAQLVSRRRREISBasic
NLS Segment(s)
PositionSequence
173-192KRQSKKREKRYAQLVSRRRR
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MSTPISRKRRRLIDDDPKFRAQTRRQLLTQRNQGEASTSHQCWPCLYREIRLNNSRLLDIERDIPTLRIRYECVRDRTDTTSCRFCHDNDHTCDDGLGMLVGNKFDVVKLNAFINDTVEIRAPDGTVPDDEDDDCAFVLPRSVRQGLVLASVRLGKAFETIVACHEREHGFNKRQSKKREKRYAQLVSRRRREISKHVPGNQDQAEGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.82
3 0.78
4 0.73
5 0.67
6 0.64
7 0.62
8 0.59
9 0.58
10 0.59
11 0.6
12 0.6
13 0.68
14 0.72
15 0.72
16 0.74
17 0.68
18 0.62
19 0.55
20 0.51
21 0.44
22 0.37
23 0.32
24 0.29
25 0.27
26 0.29
27 0.3
28 0.31
29 0.3
30 0.31
31 0.3
32 0.31
33 0.31
34 0.31
35 0.37
36 0.43
37 0.5
38 0.53
39 0.51
40 0.47
41 0.47
42 0.42
43 0.35
44 0.31
45 0.24
46 0.19
47 0.22
48 0.19
49 0.19
50 0.19
51 0.2
52 0.19
53 0.2
54 0.2
55 0.16
56 0.17
57 0.2
58 0.27
59 0.33
60 0.36
61 0.37
62 0.38
63 0.4
64 0.42
65 0.43
66 0.39
67 0.35
68 0.37
69 0.34
70 0.35
71 0.33
72 0.29
73 0.33
74 0.37
75 0.41
76 0.37
77 0.42
78 0.4
79 0.38
80 0.38
81 0.28
82 0.21
83 0.13
84 0.09
85 0.03
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.04
93 0.06
94 0.06
95 0.07
96 0.08
97 0.09
98 0.09
99 0.1
100 0.1
101 0.09
102 0.09
103 0.09
104 0.09
105 0.09
106 0.08
107 0.08
108 0.08
109 0.07
110 0.06
111 0.07
112 0.07
113 0.07
114 0.08
115 0.08
116 0.08
117 0.08
118 0.09
119 0.09
120 0.08
121 0.07
122 0.06
123 0.06
124 0.05
125 0.08
126 0.08
127 0.1
128 0.14
129 0.15
130 0.15
131 0.16
132 0.18
133 0.15
134 0.19
135 0.18
136 0.14
137 0.14
138 0.15
139 0.14
140 0.13
141 0.12
142 0.08
143 0.08
144 0.08
145 0.09
146 0.09
147 0.1
148 0.13
149 0.16
150 0.16
151 0.15
152 0.19
153 0.18
154 0.2
155 0.25
156 0.31
157 0.36
158 0.42
159 0.52
160 0.59
161 0.66
162 0.74
163 0.79
164 0.81
165 0.84
166 0.9
167 0.87
168 0.87
169 0.89
170 0.89
171 0.88
172 0.88
173 0.86
174 0.85
175 0.86
176 0.82
177 0.75
178 0.72
179 0.69
180 0.69
181 0.71
182 0.71
183 0.71
184 0.73
185 0.76
186 0.72
187 0.73
188 0.64