Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G7X6U4

Protein Details
Accession G7X6U4    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
21-40SSARIKRNPKDQQIKFKVRCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, mito_nucl 12.666, cyto_nucl 11.833, mito 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPQEISDIKQFIEVCRRKDASSARIKRNPKDQQIKFKVRCSRFVYTLVLKDSDKADKLKQSLPPALKVVDVSKGDKKKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.41
3 0.43
4 0.39
5 0.45
6 0.48
7 0.47
8 0.52
9 0.57
10 0.58
11 0.64
12 0.7
13 0.68
14 0.72
15 0.72
16 0.71
17 0.73
18 0.7
19 0.73
20 0.77
21 0.82
22 0.75
23 0.74
24 0.73
25 0.64
26 0.66
27 0.61
28 0.55
29 0.47
30 0.46
31 0.42
32 0.36
33 0.37
34 0.3
35 0.26
36 0.22
37 0.21
38 0.21
39 0.2
40 0.19
41 0.19
42 0.21
43 0.25
44 0.28
45 0.32
46 0.35
47 0.38
48 0.44
49 0.44
50 0.44
51 0.41
52 0.38
53 0.34
54 0.3
55 0.26
56 0.25
57 0.25
58 0.26
59 0.33
60 0.38