Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428PZK1

Protein Details
Accession A0A428PZK1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
70-89MIRSNKKKAAKAKAAAKKTNHydrophilic
NLS Segment(s)
PositionSequence
74-89NKKKAAKAKAAAKKTN
Subcellular Location(s) plas 17, mito 3, E.R. 3, golg 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MLDKIVGLAMLVAASVVFLYYTIWTLLMPFVDDDHPLQNFFPPRVWAIRIPVIIILLGGAVVGSFLGMVMIRSNKKKAAKAKAAAKKTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.02
3 0.02
4 0.02
5 0.02
6 0.03
7 0.04
8 0.05
9 0.05
10 0.06
11 0.06
12 0.06
13 0.07
14 0.06
15 0.06
16 0.06
17 0.07
18 0.07
19 0.08
20 0.09
21 0.1
22 0.11
23 0.11
24 0.11
25 0.13
26 0.14
27 0.14
28 0.14
29 0.13
30 0.14
31 0.15
32 0.17
33 0.15
34 0.17
35 0.19
36 0.18
37 0.17
38 0.16
39 0.14
40 0.12
41 0.11
42 0.07
43 0.03
44 0.03
45 0.02
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.01
52 0.02
53 0.02
54 0.02
55 0.03
56 0.05
57 0.1
58 0.15
59 0.19
60 0.22
61 0.29
62 0.36
63 0.43
64 0.51
65 0.57
66 0.62
67 0.68
68 0.75
69 0.78