Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428R695

Protein Details
Accession A0A428R695    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
54-79RGTVLRCTWCRRRHRPPKEWGQEWNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 12, cyto 7, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MEWDWGPKWLEHNDDQASGDSQVYDDELSGPSMVLVDHQNNRASWCICGTTLERGTVLRCTWCRRRHRPPKEWGQEWNELGRSLPVFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.34
3 0.3
4 0.28
5 0.23
6 0.2
7 0.13
8 0.11
9 0.1
10 0.09
11 0.07
12 0.06
13 0.06
14 0.06
15 0.07
16 0.07
17 0.06
18 0.06
19 0.06
20 0.05
21 0.06
22 0.07
23 0.1
24 0.12
25 0.15
26 0.16
27 0.16
28 0.18
29 0.19
30 0.18
31 0.15
32 0.14
33 0.12
34 0.11
35 0.12
36 0.13
37 0.15
38 0.16
39 0.16
40 0.15
41 0.15
42 0.16
43 0.16
44 0.16
45 0.15
46 0.17
47 0.24
48 0.33
49 0.41
50 0.51
51 0.59
52 0.7
53 0.76
54 0.84
55 0.87
56 0.88
57 0.91
58 0.9
59 0.84
60 0.81
61 0.76
62 0.73
63 0.65
64 0.6
65 0.5
66 0.4
67 0.37
68 0.32
69 0.26