Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428PIH6

Protein Details
Accession A0A428PIH6    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
60-86GSNNREIKARKPKNKGKKKIVHPSEKPBasic
NLS Segment(s)
PositionSequence
65-79EIKARKPKNKGKKKI
Subcellular Location(s) nucl 14.5, mito_nucl 12.666, cyto_nucl 9.833, mito 9.5
Family & Domain DBs
Amino Acid Sequences MAIREHFRRALRSDASGSQLEATTPGKITATITKSSQTSDKSSSSKSSFAEKLSRGWTWGSNNREIKARKPKNKGKKKIVHPSEKPMTAQNLEHQEMLSHFQWTFGTSRPEQIEGEDFEGISPCCTRAPSVVDFSLDRDSDSDGRSSSSSSSSVKSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.41
3 0.36
4 0.33
5 0.26
6 0.23
7 0.19
8 0.17
9 0.15
10 0.12
11 0.12
12 0.12
13 0.11
14 0.11
15 0.13
16 0.18
17 0.2
18 0.21
19 0.22
20 0.24
21 0.24
22 0.26
23 0.28
24 0.25
25 0.26
26 0.28
27 0.31
28 0.31
29 0.33
30 0.37
31 0.35
32 0.35
33 0.31
34 0.33
35 0.31
36 0.31
37 0.34
38 0.3
39 0.31
40 0.31
41 0.3
42 0.25
43 0.24
44 0.24
45 0.25
46 0.31
47 0.31
48 0.36
49 0.38
50 0.38
51 0.44
52 0.42
53 0.44
54 0.48
55 0.54
56 0.55
57 0.63
58 0.71
59 0.75
60 0.85
61 0.86
62 0.86
63 0.85
64 0.86
65 0.87
66 0.86
67 0.84
68 0.76
69 0.75
70 0.69
71 0.61
72 0.52
73 0.44
74 0.38
75 0.3
76 0.27
77 0.24
78 0.24
79 0.24
80 0.23
81 0.21
82 0.18
83 0.17
84 0.2
85 0.16
86 0.12
87 0.11
88 0.11
89 0.11
90 0.12
91 0.13
92 0.12
93 0.17
94 0.16
95 0.21
96 0.22
97 0.24
98 0.23
99 0.23
100 0.23
101 0.2
102 0.22
103 0.17
104 0.15
105 0.13
106 0.14
107 0.13
108 0.11
109 0.09
110 0.08
111 0.09
112 0.1
113 0.11
114 0.13
115 0.18
116 0.2
117 0.25
118 0.25
119 0.26
120 0.26
121 0.28
122 0.29
123 0.24
124 0.21
125 0.17
126 0.2
127 0.21
128 0.22
129 0.21
130 0.17
131 0.19
132 0.19
133 0.19
134 0.17
135 0.17
136 0.19
137 0.19