Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428Q4C9

Protein Details
Accession A0A428Q4C9    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
62-88HNASERPSALRNRKRRRREIDGSYSEEHydrophilic
NLS Segment(s)
PositionSequence
71-79LRNRKRRRR
Subcellular Location(s) nucl 17.5, cyto_nucl 12, cyto 5.5, pero 2
Family & Domain DBs
Amino Acid Sequences MKDWPELSEAMAPEELNGWEIRDVVRIAQASALGEDSPIIMSHLQDALDVVKTFKEKFQEGHNASERPSALRNRKRRRREIDGSYSEEGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.11
4 0.1
5 0.09
6 0.09
7 0.09
8 0.09
9 0.1
10 0.1
11 0.09
12 0.12
13 0.12
14 0.11
15 0.12
16 0.12
17 0.09
18 0.09
19 0.09
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.04
26 0.05
27 0.04
28 0.05
29 0.05
30 0.06
31 0.06
32 0.05
33 0.06
34 0.06
35 0.07
36 0.07
37 0.06
38 0.07
39 0.08
40 0.09
41 0.11
42 0.14
43 0.14
44 0.16
45 0.22
46 0.31
47 0.32
48 0.39
49 0.42
50 0.39
51 0.39
52 0.41
53 0.35
54 0.27
55 0.3
56 0.32
57 0.38
58 0.47
59 0.57
60 0.65
61 0.75
62 0.83
63 0.89
64 0.89
65 0.88
66 0.89
67 0.88
68 0.87
69 0.83
70 0.79