Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G7XAP9

Protein Details
Accession G7XAP9    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
22-42AGPRKRARVEKPKKPAKEQRDBasic
NLS Segment(s)
PositionSequence
23-75GPRKRARVEKPKKPAKEQRDIAKMSAVEKKKEIARLRAAIKKEEEELKRKREK
Subcellular Location(s) mito 12, nucl 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MERPTQAIFHNAVFLAGSFSGAGPRKRARVEKPKKPAKEQRDIAKMSAVEKKKEIARLRAAIKKEEEELKRKREKVTALKASILADEADDKLMIEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.09
4 0.09
5 0.07
6 0.07
7 0.12
8 0.16
9 0.17
10 0.21
11 0.25
12 0.29
13 0.35
14 0.42
15 0.46
16 0.54
17 0.63
18 0.67
19 0.75
20 0.79
21 0.79
22 0.82
23 0.82
24 0.79
25 0.79
26 0.75
27 0.73
28 0.7
29 0.66
30 0.57
31 0.5
32 0.42
33 0.34
34 0.35
35 0.28
36 0.22
37 0.21
38 0.23
39 0.23
40 0.3
41 0.31
42 0.31
43 0.34
44 0.39
45 0.43
46 0.46
47 0.45
48 0.41
49 0.4
50 0.35
51 0.33
52 0.35
53 0.34
54 0.38
55 0.43
56 0.48
57 0.54
58 0.56
59 0.57
60 0.56
61 0.6
62 0.62
63 0.66
64 0.66
65 0.6
66 0.58
67 0.56
68 0.5
69 0.41
70 0.32
71 0.21
72 0.13
73 0.12
74 0.11
75 0.11
76 0.1