Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428QA21

Protein Details
Accession A0A428QA21    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
39-62VTKGKGFTKEKNKKKRGSYRGGMIBasic
NLS Segment(s)
PositionSequence
43-55KGFTKEKNKKKRG
Subcellular Location(s) nucl 18, mito 6, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
Amino Acid Sequences KQNEPFSRIPKNIKVDPKFASNEYVPIAYSQRAHEDLIVTKGKGFTKEKNKKKRGSYRGGMIDISEKKGIYFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.62
3 0.58
4 0.56
5 0.51
6 0.45
7 0.42
8 0.32
9 0.3
10 0.26
11 0.23
12 0.18
13 0.15
14 0.16
15 0.12
16 0.13
17 0.12
18 0.14
19 0.15
20 0.15
21 0.14
22 0.14
23 0.14
24 0.16
25 0.16
26 0.13
27 0.13
28 0.15
29 0.16
30 0.19
31 0.22
32 0.26
33 0.36
34 0.47
35 0.57
36 0.65
37 0.73
38 0.76
39 0.84
40 0.87
41 0.85
42 0.84
43 0.81
44 0.79
45 0.76
46 0.7
47 0.6
48 0.5
49 0.48
50 0.4
51 0.37
52 0.3
53 0.23
54 0.21