Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428Q1U9

Protein Details
Accession A0A428Q1U9    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-42ATDGIDKARRLRRKRKAETQDNERLSKHydrophilic
NLS Segment(s)
PositionSequence
22-31KARRLRRKRK
Subcellular Location(s) nucl 23, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046591  DUF6649  
Pfam View protein in Pfam  
PF20354  DUF6649  
Amino Acid Sequences MLHGAQSPSTSAAPVATDGIDKARRLRRKRKAETQDNERLSKRLSLLNIEQSGSKLYVPVEEPSIPTPSIPNVAPSSSSSAPDRSVPNDSMQLDDSKHKVYIYNIDDELSSDSESDDPGKLVFLSDIEKHLRVNRIPPAVLANSEGELAGMQLVLYSDPKSLTVPEDKDSVRKAIIESRHRTREQQRLEREGKTNTPSVDSDSTNDAIVPPTYTDDDPDAMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.09
4 0.1
5 0.1
6 0.16
7 0.19
8 0.19
9 0.26
10 0.34
11 0.44
12 0.53
13 0.64
14 0.69
15 0.76
16 0.85
17 0.88
18 0.9
19 0.91
20 0.91
21 0.89
22 0.89
23 0.83
24 0.78
25 0.68
26 0.59
27 0.5
28 0.44
29 0.37
30 0.31
31 0.28
32 0.28
33 0.31
34 0.36
35 0.35
36 0.32
37 0.3
38 0.26
39 0.27
40 0.21
41 0.17
42 0.11
43 0.1
44 0.11
45 0.13
46 0.13
47 0.14
48 0.14
49 0.16
50 0.16
51 0.19
52 0.16
53 0.15
54 0.15
55 0.13
56 0.15
57 0.13
58 0.14
59 0.13
60 0.14
61 0.15
62 0.15
63 0.2
64 0.18
65 0.19
66 0.18
67 0.18
68 0.19
69 0.2
70 0.21
71 0.18
72 0.21
73 0.2
74 0.2
75 0.23
76 0.22
77 0.21
78 0.2
79 0.19
80 0.16
81 0.17
82 0.18
83 0.15
84 0.15
85 0.14
86 0.14
87 0.14
88 0.2
89 0.2
90 0.21
91 0.2
92 0.2
93 0.19
94 0.19
95 0.19
96 0.11
97 0.09
98 0.07
99 0.07
100 0.06
101 0.07
102 0.07
103 0.06
104 0.05
105 0.05
106 0.05
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.07
113 0.1
114 0.11
115 0.12
116 0.13
117 0.16
118 0.2
119 0.19
120 0.23
121 0.26
122 0.27
123 0.26
124 0.26
125 0.26
126 0.22
127 0.22
128 0.19
129 0.14
130 0.11
131 0.11
132 0.11
133 0.07
134 0.06
135 0.06
136 0.04
137 0.03
138 0.03
139 0.03
140 0.03
141 0.03
142 0.05
143 0.05
144 0.06
145 0.07
146 0.08
147 0.08
148 0.09
149 0.12
150 0.17
151 0.19
152 0.2
153 0.24
154 0.24
155 0.27
156 0.29
157 0.27
158 0.22
159 0.21
160 0.21
161 0.23
162 0.32
163 0.37
164 0.42
165 0.49
166 0.56
167 0.57
168 0.63
169 0.65
170 0.66
171 0.67
172 0.7
173 0.69
174 0.7
175 0.73
176 0.71
177 0.67
178 0.63
179 0.58
180 0.52
181 0.49
182 0.4
183 0.39
184 0.35
185 0.35
186 0.34
187 0.29
188 0.28
189 0.27
190 0.27
191 0.24
192 0.23
193 0.17
194 0.16
195 0.15
196 0.14
197 0.11
198 0.14
199 0.17
200 0.17
201 0.19
202 0.2
203 0.2
204 0.19