Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G7XP02

Protein Details
Accession G7XP02    Localization Confidence High Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
353-381LSVTRGKGFTKEKNKKKRGSYRGGPIDISHydrophilic
NLS Segment(s)
PositionSequence
137-145KKPAAPAAK
359-372KGFTKEKNKKKRGS
Subcellular Location(s) nucl 21, cyto 3, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006594  LisH  
IPR007718  Srp40_C  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF05022  SRP40_C  
PROSITE View protein in PROSITE  
PS50896  LISH  
Amino Acid Sequences MAGQKSKQAKPAKVSKSKETPAPPAQLVAAISAFLSESGLSKTKETFAKELSSKSIDSDAKNVPSLLELYQSWEKTSEKSSGSSSSDSESDSESESGSESDSESSDSSSDESSDSDVEMNDKSESDSDSDSDEEEKKKPAAPAAKSQGTKRKAESSSSESDSESESDEAPKSKKTKVTSAKEESSDSDSSDSESDSSSSSSESEVSSDSDSSSDDSSSSSESDSDSDSDSDSDSSSDEEDDKKADKKALKAATKTPLPPSDSSSSGSSSSSSSDSDSTGTVSNSDSAAKEQSQSAQTSASSSASPAPGNAPQKKKHTGARPTPLAQLSEGPTDHLLSNDYVPYAYAEKAWQDLSVTRGKGFTKEKNKKKRGSYRGGPIDISGGKSFKFDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.77
3 0.78
4 0.76
5 0.75
6 0.71
7 0.7
8 0.67
9 0.67
10 0.58
11 0.5
12 0.45
13 0.39
14 0.33
15 0.25
16 0.18
17 0.11
18 0.1
19 0.09
20 0.08
21 0.06
22 0.06
23 0.05
24 0.06
25 0.1
26 0.14
27 0.15
28 0.17
29 0.19
30 0.24
31 0.28
32 0.32
33 0.32
34 0.32
35 0.38
36 0.4
37 0.4
38 0.4
39 0.38
40 0.34
41 0.31
42 0.35
43 0.32
44 0.3
45 0.34
46 0.34
47 0.33
48 0.34
49 0.32
50 0.25
51 0.22
52 0.22
53 0.17
54 0.15
55 0.12
56 0.17
57 0.22
58 0.22
59 0.22
60 0.23
61 0.24
62 0.23
63 0.26
64 0.26
65 0.22
66 0.24
67 0.26
68 0.28
69 0.3
70 0.29
71 0.27
72 0.24
73 0.23
74 0.22
75 0.2
76 0.17
77 0.14
78 0.15
79 0.14
80 0.12
81 0.11
82 0.11
83 0.1
84 0.09
85 0.08
86 0.07
87 0.08
88 0.08
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.09
96 0.09
97 0.08
98 0.08
99 0.09
100 0.09
101 0.09
102 0.08
103 0.08
104 0.09
105 0.09
106 0.09
107 0.09
108 0.08
109 0.09
110 0.09
111 0.1
112 0.11
113 0.11
114 0.1
115 0.12
116 0.12
117 0.11
118 0.13
119 0.16
120 0.16
121 0.17
122 0.19
123 0.19
124 0.22
125 0.23
126 0.26
127 0.31
128 0.31
129 0.38
130 0.43
131 0.48
132 0.47
133 0.51
134 0.54
135 0.5
136 0.5
137 0.44
138 0.45
139 0.4
140 0.42
141 0.42
142 0.39
143 0.4
144 0.4
145 0.38
146 0.3
147 0.28
148 0.26
149 0.21
150 0.16
151 0.12
152 0.1
153 0.1
154 0.11
155 0.13
156 0.13
157 0.17
158 0.18
159 0.22
160 0.26
161 0.28
162 0.37
163 0.45
164 0.51
165 0.56
166 0.59
167 0.58
168 0.55
169 0.52
170 0.44
171 0.39
172 0.31
173 0.23
174 0.18
175 0.15
176 0.14
177 0.13
178 0.11
179 0.07
180 0.07
181 0.07
182 0.07
183 0.07
184 0.06
185 0.06
186 0.06
187 0.06
188 0.07
189 0.06
190 0.06
191 0.07
192 0.08
193 0.08
194 0.08
195 0.07
196 0.07
197 0.07
198 0.08
199 0.08
200 0.07
201 0.06
202 0.07
203 0.07
204 0.08
205 0.08
206 0.07
207 0.07
208 0.07
209 0.08
210 0.08
211 0.08
212 0.09
213 0.08
214 0.09
215 0.09
216 0.09
217 0.08
218 0.07
219 0.07
220 0.06
221 0.06
222 0.06
223 0.07
224 0.07
225 0.08
226 0.09
227 0.1
228 0.12
229 0.15
230 0.16
231 0.21
232 0.23
233 0.25
234 0.33
235 0.4
236 0.43
237 0.43
238 0.47
239 0.49
240 0.49
241 0.48
242 0.45
243 0.41
244 0.39
245 0.37
246 0.37
247 0.34
248 0.31
249 0.32
250 0.28
251 0.25
252 0.22
253 0.21
254 0.17
255 0.14
256 0.14
257 0.13
258 0.12
259 0.12
260 0.11
261 0.12
262 0.12
263 0.11
264 0.11
265 0.11
266 0.11
267 0.1
268 0.1
269 0.1
270 0.1
271 0.11
272 0.1
273 0.1
274 0.13
275 0.13
276 0.14
277 0.14
278 0.17
279 0.19
280 0.2
281 0.19
282 0.18
283 0.17
284 0.18
285 0.18
286 0.15
287 0.12
288 0.12
289 0.13
290 0.14
291 0.14
292 0.12
293 0.14
294 0.19
295 0.28
296 0.35
297 0.4
298 0.45
299 0.52
300 0.58
301 0.61
302 0.63
303 0.65
304 0.68
305 0.7
306 0.74
307 0.73
308 0.69
309 0.69
310 0.63
311 0.54
312 0.45
313 0.38
314 0.32
315 0.28
316 0.26
317 0.22
318 0.2
319 0.21
320 0.2
321 0.16
322 0.15
323 0.13
324 0.15
325 0.14
326 0.13
327 0.11
328 0.11
329 0.13
330 0.13
331 0.12
332 0.12
333 0.13
334 0.13
335 0.16
336 0.16
337 0.14
338 0.14
339 0.16
340 0.19
341 0.24
342 0.24
343 0.23
344 0.26
345 0.27
346 0.33
347 0.38
348 0.44
349 0.49
350 0.58
351 0.68
352 0.76
353 0.85
354 0.86
355 0.9
356 0.91
357 0.9
358 0.9
359 0.89
360 0.88
361 0.88
362 0.82
363 0.72
364 0.62
365 0.57
366 0.48
367 0.42
368 0.34
369 0.26
370 0.23