Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G7XRY8

Protein Details
Accession G7XRY8    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
180-212IRGLSRAERKDRIRRNERKMRANERKSRKSGGGBasic
NLS Segment(s)
PositionSequence
103-132KWELFARKKGIGKYSSRPGAALADKERRKK
176-212KGSSIRGLSRAERKDRIRRNERKMRANERKSRKSGGG
Subcellular Location(s) nucl 19.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007023  Ribosom_reg  
Gene Ontology GO:0005634  C:nucleus  
GO:0042254  P:ribosome biogenesis  
Pfam View protein in Pfam  
PF04939  RRS1  
Amino Acid Sequences MASTDSKPKPERLPVTVSKPTPYTFDLGHLLANDPNPLEISRSEPLDVSLKATARDGTQSLLNQLLTTCPITSSQQGVLLTLPPPTTVLPRFKPLPTPKPPTKWELFARKKGIGKYSSRPGAALADKERRKKLVYDEEKGEWVPRWGYKGKNKSDDEWLVEVNEKDWKKEEEAAAKGSSIRGLSRAERKDRIRRNERKMRANERKSRKSGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.64
3 0.66
4 0.61
5 0.54
6 0.5
7 0.46
8 0.42
9 0.37
10 0.31
11 0.24
12 0.25
13 0.25
14 0.23
15 0.23
16 0.19
17 0.19
18 0.17
19 0.17
20 0.15
21 0.12
22 0.12
23 0.12
24 0.11
25 0.12
26 0.11
27 0.15
28 0.17
29 0.18
30 0.18
31 0.17
32 0.19
33 0.21
34 0.2
35 0.17
36 0.18
37 0.17
38 0.17
39 0.18
40 0.17
41 0.14
42 0.16
43 0.14
44 0.13
45 0.14
46 0.14
47 0.15
48 0.15
49 0.15
50 0.12
51 0.12
52 0.11
53 0.1
54 0.1
55 0.09
56 0.08
57 0.09
58 0.11
59 0.12
60 0.14
61 0.13
62 0.15
63 0.15
64 0.15
65 0.14
66 0.13
67 0.12
68 0.11
69 0.1
70 0.07
71 0.08
72 0.08
73 0.11
74 0.14
75 0.19
76 0.2
77 0.24
78 0.26
79 0.26
80 0.34
81 0.38
82 0.44
83 0.46
84 0.52
85 0.54
86 0.58
87 0.6
88 0.57
89 0.52
90 0.48
91 0.47
92 0.5
93 0.5
94 0.51
95 0.52
96 0.51
97 0.52
98 0.48
99 0.47
100 0.41
101 0.39
102 0.38
103 0.41
104 0.4
105 0.37
106 0.35
107 0.3
108 0.29
109 0.26
110 0.24
111 0.21
112 0.27
113 0.31
114 0.37
115 0.38
116 0.37
117 0.37
118 0.37
119 0.41
120 0.43
121 0.46
122 0.46
123 0.48
124 0.47
125 0.46
126 0.43
127 0.36
128 0.26
129 0.2
130 0.18
131 0.15
132 0.18
133 0.2
134 0.28
135 0.36
136 0.44
137 0.5
138 0.57
139 0.59
140 0.57
141 0.61
142 0.57
143 0.52
144 0.45
145 0.38
146 0.3
147 0.3
148 0.27
149 0.19
150 0.23
151 0.19
152 0.19
153 0.22
154 0.23
155 0.24
156 0.29
157 0.33
158 0.33
159 0.36
160 0.37
161 0.34
162 0.32
163 0.3
164 0.25
165 0.22
166 0.15
167 0.13
168 0.13
169 0.16
170 0.22
171 0.3
172 0.38
173 0.43
174 0.51
175 0.58
176 0.66
177 0.73
178 0.78
179 0.8
180 0.82
181 0.86
182 0.88
183 0.89
184 0.89
185 0.89
186 0.9
187 0.9
188 0.9
189 0.9
190 0.9
191 0.91
192 0.86