Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428NI65

Protein Details
Accession A0A428NI65    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
37-62PPKLPLIHICRRRRRLKCTSRCSLYLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 6.5, cyto_nucl 4.5, extr 4
Family & Domain DBs
Amino Acid Sequences MASIFSLGGLFTRRATAPAAPTTRLFSTTTSLLARAPPKLPLIHICRRRRRLKCTSRCSLYLSTLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.17
4 0.18
5 0.25
6 0.26
7 0.26
8 0.26
9 0.29
10 0.27
11 0.26
12 0.23
13 0.17
14 0.18
15 0.16
16 0.17
17 0.14
18 0.14
19 0.12
20 0.14
21 0.14
22 0.14
23 0.14
24 0.14
25 0.15
26 0.16
27 0.17
28 0.21
29 0.27
30 0.34
31 0.44
32 0.51
33 0.6
34 0.69
35 0.78
36 0.79
37 0.81
38 0.84
39 0.85
40 0.87
41 0.86
42 0.86
43 0.82
44 0.76
45 0.73
46 0.65