Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NRU2

Protein Details
Accession A0A428NRU2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
188-212ALRALLPQIRPRRGRKRPAEDEVVTHydrophilic
NLS Segment(s)
PositionSequence
197-204RPRRGRKR
Subcellular Location(s) nucl 14.5, cyto_nucl 10.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018562  ARS-binding_2  
Pfam View protein in Pfam  
PF09441  Abp2  
Amino Acid Sequences MPSPNNPPPPPPLSQPAASQPGPSAPGSVATPNIPVRPELPDRRVTADTIEDAYVRFMLYCNPGISPSTPTITLREAFRNPPRSGGKTFSTFAVYELVRKFYDNEIRTWTELTTRLGVEPPDPSKEESAQKIAQYGVRLKKWMNSMHVKAFFEYLMDIPNDYWTKIPADTNPTSQPMRDGVALEDDMALRALLPQIRPRRGRKRPAEDEVVT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.44
4 0.46
5 0.42
6 0.37
7 0.31
8 0.29
9 0.3
10 0.26
11 0.2
12 0.14
13 0.16
14 0.16
15 0.17
16 0.15
17 0.13
18 0.17
19 0.18
20 0.2
21 0.18
22 0.18
23 0.18
24 0.22
25 0.3
26 0.33
27 0.36
28 0.4
29 0.42
30 0.46
31 0.46
32 0.41
33 0.35
34 0.29
35 0.26
36 0.22
37 0.2
38 0.14
39 0.13
40 0.13
41 0.11
42 0.09
43 0.07
44 0.06
45 0.08
46 0.11
47 0.13
48 0.13
49 0.13
50 0.14
51 0.15
52 0.16
53 0.17
54 0.16
55 0.15
56 0.16
57 0.16
58 0.17
59 0.18
60 0.19
61 0.18
62 0.21
63 0.22
64 0.27
65 0.34
66 0.39
67 0.37
68 0.43
69 0.45
70 0.44
71 0.45
72 0.42
73 0.38
74 0.34
75 0.35
76 0.28
77 0.26
78 0.22
79 0.2
80 0.18
81 0.15
82 0.15
83 0.15
84 0.16
85 0.14
86 0.14
87 0.15
88 0.16
89 0.24
90 0.22
91 0.23
92 0.25
93 0.26
94 0.26
95 0.25
96 0.21
97 0.15
98 0.16
99 0.16
100 0.13
101 0.12
102 0.12
103 0.12
104 0.12
105 0.11
106 0.13
107 0.13
108 0.14
109 0.15
110 0.16
111 0.17
112 0.2
113 0.23
114 0.22
115 0.25
116 0.24
117 0.23
118 0.23
119 0.22
120 0.21
121 0.2
122 0.24
123 0.25
124 0.25
125 0.27
126 0.26
127 0.3
128 0.34
129 0.35
130 0.35
131 0.37
132 0.4
133 0.45
134 0.49
135 0.46
136 0.4
137 0.37
138 0.3
139 0.23
140 0.2
141 0.13
142 0.1
143 0.09
144 0.09
145 0.08
146 0.14
147 0.14
148 0.14
149 0.14
150 0.13
151 0.15
152 0.16
153 0.18
154 0.16
155 0.23
156 0.25
157 0.29
158 0.31
159 0.33
160 0.33
161 0.31
162 0.3
163 0.24
164 0.24
165 0.21
166 0.19
167 0.15
168 0.18
169 0.18
170 0.16
171 0.14
172 0.12
173 0.11
174 0.11
175 0.09
176 0.06
177 0.06
178 0.09
179 0.11
180 0.14
181 0.22
182 0.32
183 0.41
184 0.49
185 0.58
186 0.67
187 0.74
188 0.83
189 0.85
190 0.87
191 0.87
192 0.88