Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A428P4B3

Protein Details
Accession A0A428P4B3    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
48-72AAGVQKPRKKAQKRPVRPRNLQVFPHydrophilic
NLS Segment(s)
PositionSequence
50-66GVQKPRKKAQKRPVRPR
Subcellular Location(s) nucl 12.5, cyto_nucl 7.5, mito 7, extr 5
Family & Domain DBs
Amino Acid Sequences MSSTNKKVASGGDGLDLSALTPAQLRAFGAGFAAGAAARAAAGGNGPAAGVQKPRKKAQKRPVRPRNLQVFPGSPGQGGGQGQGRRPPFPFLSPHHQAAIHLVRGLATSRCSVTTSTPLYILT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.14
4 0.1
5 0.08
6 0.07
7 0.04
8 0.05
9 0.06
10 0.07
11 0.07
12 0.07
13 0.08
14 0.09
15 0.09
16 0.08
17 0.07
18 0.06
19 0.05
20 0.05
21 0.04
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.05
37 0.1
38 0.17
39 0.22
40 0.26
41 0.34
42 0.43
43 0.5
44 0.6
45 0.65
46 0.7
47 0.76
48 0.83
49 0.87
50 0.86
51 0.84
52 0.82
53 0.81
54 0.73
55 0.65
56 0.56
57 0.47
58 0.4
59 0.37
60 0.29
61 0.19
62 0.16
63 0.14
64 0.13
65 0.12
66 0.11
67 0.14
68 0.15
69 0.16
70 0.21
71 0.23
72 0.23
73 0.25
74 0.28
75 0.25
76 0.27
77 0.31
78 0.32
79 0.39
80 0.42
81 0.43
82 0.4
83 0.37
84 0.34
85 0.36
86 0.35
87 0.27
88 0.23
89 0.2
90 0.19
91 0.19
92 0.21
93 0.15
94 0.12
95 0.13
96 0.14
97 0.15
98 0.17
99 0.17
100 0.19
101 0.25
102 0.27
103 0.27