Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A428NGE1

Protein Details
Accession A0A428NGE1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
46-65LSMSRKKLRRLWPRSPSFRRHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto 7.5, mito_nucl 7.5, mito 6
Family & Domain DBs
Amino Acid Sequences MDDGNLAQPPDLRFWQASRQPSMSVSVVESSGIASLNIRGTMVRCLSMSRKKLRRLWPRSPSFRRIEYHRAYSESLSVDIGLIQIANLPLSFVVAGCGTGCSVSEPWCDLSETK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.33
3 0.37
4 0.41
5 0.41
6 0.41
7 0.39
8 0.39
9 0.4
10 0.31
11 0.25
12 0.21
13 0.16
14 0.14
15 0.13
16 0.12
17 0.08
18 0.07
19 0.07
20 0.05
21 0.05
22 0.06
23 0.07
24 0.07
25 0.07
26 0.06
27 0.07
28 0.11
29 0.11
30 0.11
31 0.1
32 0.12
33 0.18
34 0.26
35 0.31
36 0.37
37 0.44
38 0.5
39 0.58
40 0.66
41 0.71
42 0.72
43 0.76
44 0.77
45 0.78
46 0.81
47 0.79
48 0.76
49 0.69
50 0.65
51 0.58
52 0.55
53 0.55
54 0.49
55 0.49
56 0.44
57 0.42
58 0.39
59 0.36
60 0.32
61 0.24
62 0.2
63 0.14
64 0.12
65 0.1
66 0.08
67 0.08
68 0.05
69 0.04
70 0.03
71 0.04
72 0.04
73 0.05
74 0.04
75 0.05
76 0.04
77 0.05
78 0.05
79 0.04
80 0.05
81 0.05
82 0.06
83 0.06
84 0.06
85 0.06
86 0.06
87 0.06
88 0.08
89 0.09
90 0.12
91 0.13
92 0.15
93 0.18
94 0.19