Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401H496

Protein Details
Accession A0A401H496   
Localization Confidence Medium
Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
222-248DSPPTPSPSPSKRKVRKRLFAAQNPFQHydrophilic
NLS Segment(s)
PositionSequence
233-238KRKVRK
Subcellular Location(s) nucl 23.5, cyto_nucl 14.333, mito_nucl 12.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR015637  MUG/TDG  
IPR036895  Uracil-DNA_glycosylase-like_sf  
Gene Ontology GO:0000700  F:mismatch base pair DNA N-glycosylase activity  
GO:0006285  P:base-excision repair, AP site formation  
Amino Acid Sequences MKVSETDDSDVVEGDAASIQHLRTTLTAFKFVGNPGGTKTSPQLQNATGALDSNVTGSSNMSYSTPLPRTEQSPALRRSPRKPKSVAKVEDRNAELFLQTTPERSVSISLKDGVLGSQSSTSPSRRKLKSRVQIKRGFASPETYAHLLPLQDYLKEELDVLFCGINKQESELAASEFTTGVPVLLQKIARFRPQVVCFVGKGIWDAFERALPLVRRETIQLDSPPTPSPSPSKRKVRKRLFAAQNPFQWDIQPYKVVHPNDGTDNVLETLFFVTPSTSGRVTSHQLPQKTALFTLLRQRMEEAKRGEINTESMTVISSPPPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.08
3 0.07
4 0.08
5 0.09
6 0.09
7 0.1
8 0.11
9 0.12
10 0.11
11 0.15
12 0.21
13 0.22
14 0.26
15 0.25
16 0.27
17 0.28
18 0.28
19 0.31
20 0.25
21 0.24
22 0.23
23 0.28
24 0.26
25 0.25
26 0.28
27 0.3
28 0.33
29 0.35
30 0.35
31 0.31
32 0.35
33 0.33
34 0.32
35 0.23
36 0.19
37 0.17
38 0.13
39 0.12
40 0.09
41 0.09
42 0.07
43 0.07
44 0.07
45 0.08
46 0.08
47 0.08
48 0.08
49 0.1
50 0.11
51 0.18
52 0.2
53 0.21
54 0.24
55 0.25
56 0.28
57 0.31
58 0.37
59 0.36
60 0.42
61 0.44
62 0.49
63 0.56
64 0.58
65 0.63
66 0.67
67 0.69
68 0.68
69 0.72
70 0.73
71 0.75
72 0.8
73 0.77
74 0.75
75 0.77
76 0.72
77 0.71
78 0.63
79 0.54
80 0.44
81 0.37
82 0.28
83 0.19
84 0.16
85 0.13
86 0.11
87 0.12
88 0.12
89 0.12
90 0.12
91 0.12
92 0.16
93 0.14
94 0.17
95 0.17
96 0.16
97 0.16
98 0.15
99 0.15
100 0.11
101 0.1
102 0.08
103 0.07
104 0.07
105 0.07
106 0.1
107 0.12
108 0.16
109 0.19
110 0.27
111 0.35
112 0.4
113 0.47
114 0.54
115 0.62
116 0.67
117 0.74
118 0.76
119 0.76
120 0.78
121 0.74
122 0.69
123 0.61
124 0.55
125 0.45
126 0.38
127 0.3
128 0.24
129 0.23
130 0.2
131 0.17
132 0.15
133 0.15
134 0.12
135 0.11
136 0.12
137 0.1
138 0.09
139 0.1
140 0.11
141 0.11
142 0.11
143 0.11
144 0.08
145 0.08
146 0.08
147 0.08
148 0.06
149 0.06
150 0.06
151 0.06
152 0.06
153 0.06
154 0.07
155 0.08
156 0.07
157 0.09
158 0.09
159 0.1
160 0.09
161 0.09
162 0.08
163 0.07
164 0.07
165 0.05
166 0.05
167 0.04
168 0.04
169 0.04
170 0.05
171 0.07
172 0.07
173 0.08
174 0.13
175 0.16
176 0.2
177 0.22
178 0.24
179 0.3
180 0.32
181 0.35
182 0.33
183 0.32
184 0.28
185 0.28
186 0.25
187 0.17
188 0.16
189 0.12
190 0.11
191 0.1
192 0.11
193 0.1
194 0.1
195 0.1
196 0.09
197 0.13
198 0.12
199 0.14
200 0.16
201 0.16
202 0.16
203 0.17
204 0.2
205 0.18
206 0.21
207 0.21
208 0.23
209 0.23
210 0.25
211 0.25
212 0.25
213 0.23
214 0.21
215 0.27
216 0.32
217 0.39
218 0.47
219 0.56
220 0.63
221 0.73
222 0.82
223 0.86
224 0.86
225 0.86
226 0.87
227 0.87
228 0.86
229 0.84
230 0.8
231 0.74
232 0.69
233 0.63
234 0.52
235 0.43
236 0.37
237 0.32
238 0.27
239 0.28
240 0.24
241 0.27
242 0.35
243 0.34
244 0.35
245 0.34
246 0.34
247 0.33
248 0.33
249 0.29
250 0.22
251 0.22
252 0.19
253 0.17
254 0.14
255 0.1
256 0.1
257 0.09
258 0.09
259 0.08
260 0.07
261 0.08
262 0.1
263 0.13
264 0.12
265 0.13
266 0.15
267 0.19
268 0.24
269 0.29
270 0.36
271 0.39
272 0.41
273 0.42
274 0.46
275 0.47
276 0.44
277 0.39
278 0.35
279 0.3
280 0.31
281 0.38
282 0.4
283 0.36
284 0.35
285 0.38
286 0.41
287 0.43
288 0.48
289 0.42
290 0.43
291 0.47
292 0.47
293 0.46
294 0.39
295 0.38
296 0.33
297 0.3
298 0.23
299 0.18
300 0.18
301 0.16
302 0.16