Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A401GXU7

Protein Details
Accession A0A401GXU7    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-36ESARRMTRSDSRRSRHRRSDHGGAABasic
NLS Segment(s)
PositionSequence
128-132RLRKK
Subcellular Location(s) nucl 15, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MPQWYWTAYRSESARRMTRSDSRRSRHRRSDHGGAALRMDCSLFLGVPDGRPKIHTDRLAGYHICPPLRPSRQAAAAAARNLCQVAFEGTLSELPAAESPRPVYVSWVFSSAFSVNPDTATARLRTPRLRKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.49
3 0.51
4 0.52
5 0.57
6 0.57
7 0.61
8 0.63
9 0.64
10 0.71
11 0.77
12 0.8
13 0.82
14 0.83
15 0.82
16 0.8
17 0.82
18 0.76
19 0.74
20 0.67
21 0.57
22 0.51
23 0.42
24 0.34
25 0.24
26 0.19
27 0.11
28 0.09
29 0.09
30 0.06
31 0.05
32 0.07
33 0.08
34 0.09
35 0.13
36 0.12
37 0.12
38 0.13
39 0.17
40 0.2
41 0.26
42 0.27
43 0.26
44 0.28
45 0.31
46 0.33
47 0.3
48 0.25
49 0.23
50 0.23
51 0.2
52 0.17
53 0.17
54 0.23
55 0.26
56 0.26
57 0.26
58 0.27
59 0.3
60 0.31
61 0.3
62 0.26
63 0.25
64 0.25
65 0.22
66 0.19
67 0.16
68 0.15
69 0.14
70 0.09
71 0.07
72 0.08
73 0.08
74 0.07
75 0.07
76 0.08
77 0.08
78 0.08
79 0.08
80 0.05
81 0.05
82 0.07
83 0.09
84 0.09
85 0.1
86 0.11
87 0.13
88 0.15
89 0.14
90 0.18
91 0.19
92 0.22
93 0.22
94 0.23
95 0.21
96 0.2
97 0.23
98 0.18
99 0.17
100 0.15
101 0.17
102 0.15
103 0.15
104 0.16
105 0.15
106 0.16
107 0.18
108 0.18
109 0.21
110 0.27
111 0.32
112 0.41