Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LDU0

Protein Details
Accession E2LDU0    Localization Confidence Medium Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
94-113GKVNGKPTTRKRAKVDQGEIHydrophilic
NLS Segment(s)
PositionSequence
82-107KPKKPGAKSKANGKVNGKPTTRKRAK
Subcellular Location(s) nucl 15.5, cyto_nucl 12.5, cyto 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041507  UCH_C  
KEGG mpr:MPER_04463  -  
Pfam View protein in Pfam  
PF18031  UCH_C  
Amino Acid Sequences LCIPSYDERCLDSQNESTRAFGCMERAIESGMRAKVALEDELKKGCRDHTDHIKRTHDYEPFLTEFITCLHAQGLVDALVNKPKKPGAKSKANGKVNGKPTTRKRAKVDQGEIEDGNWKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.35
3 0.34
4 0.33
5 0.31
6 0.31
7 0.28
8 0.22
9 0.19
10 0.17
11 0.17
12 0.18
13 0.18
14 0.17
15 0.16
16 0.16
17 0.19
18 0.16
19 0.15
20 0.13
21 0.13
22 0.13
23 0.14
24 0.15
25 0.13
26 0.15
27 0.17
28 0.2
29 0.21
30 0.2
31 0.19
32 0.19
33 0.21
34 0.23
35 0.28
36 0.36
37 0.45
38 0.51
39 0.56
40 0.58
41 0.54
42 0.54
43 0.52
44 0.43
45 0.35
46 0.3
47 0.27
48 0.24
49 0.23
50 0.19
51 0.14
52 0.12
53 0.1
54 0.12
55 0.09
56 0.08
57 0.08
58 0.08
59 0.08
60 0.08
61 0.08
62 0.05
63 0.06
64 0.06
65 0.06
66 0.12
67 0.14
68 0.14
69 0.15
70 0.19
71 0.24
72 0.29
73 0.39
74 0.41
75 0.51
76 0.57
77 0.65
78 0.72
79 0.71
80 0.73
81 0.68
82 0.68
83 0.65
84 0.68
85 0.61
86 0.6
87 0.64
88 0.68
89 0.71
90 0.71
91 0.7
92 0.73
93 0.79
94 0.8
95 0.8
96 0.77
97 0.74
98 0.71
99 0.63
100 0.53