Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GKR3

Protein Details
Accession A0A401GKR3    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
275-294GNPGAGRRGKKNGKAGRQNTHydrophilic
NLS Segment(s)
PositionSequence
252-261KGKNKRKGKG
277-290PGAGRRGKKNGKAG
Subcellular Location(s) nucl 13, cyto_nucl 12, cyto 9, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR036882  Alba-like_dom_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MSSSEPSRRPAAQKRRLEPADDEAGPSKRLRTEATNPAPRTGGPSTSGQTVELETDRLEADSGTLAAARPVQGANGEASRTDAADKGKGKAKDTDTTTRKDTGKGGADPSTHKIRKLVPPRPFPTVPTSVSATGPRSAHTEGKNYICITRHTPLGGYLRRCKDVILKDGYKNLHLSAMGAAIPHLMLLTVSLPSILPFPPDEVHTEILTGTVEVQDELIPEDEDEDISYRTRGKSTVSVVIKIGDGVDEVLKGKNKRKGKGGGYQAADTVGAAGGNPGAGRRGKKNGKAGRQNTVGGSGPAPIVVREDEMETV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.79
3 0.76
4 0.71
5 0.64
6 0.6
7 0.57
8 0.47
9 0.45
10 0.39
11 0.38
12 0.36
13 0.32
14 0.29
15 0.25
16 0.27
17 0.28
18 0.31
19 0.37
20 0.46
21 0.55
22 0.61
23 0.59
24 0.59
25 0.56
26 0.48
27 0.46
28 0.38
29 0.3
30 0.24
31 0.26
32 0.26
33 0.28
34 0.28
35 0.22
36 0.2
37 0.19
38 0.18
39 0.15
40 0.14
41 0.11
42 0.12
43 0.11
44 0.11
45 0.1
46 0.07
47 0.07
48 0.07
49 0.07
50 0.06
51 0.06
52 0.06
53 0.06
54 0.07
55 0.07
56 0.08
57 0.08
58 0.08
59 0.08
60 0.09
61 0.1
62 0.11
63 0.1
64 0.09
65 0.11
66 0.11
67 0.11
68 0.11
69 0.12
70 0.12
71 0.18
72 0.2
73 0.22
74 0.28
75 0.3
76 0.31
77 0.36
78 0.38
79 0.39
80 0.43
81 0.5
82 0.47
83 0.49
84 0.49
85 0.48
86 0.45
87 0.4
88 0.37
89 0.33
90 0.34
91 0.32
92 0.32
93 0.29
94 0.29
95 0.29
96 0.32
97 0.35
98 0.31
99 0.3
100 0.3
101 0.32
102 0.4
103 0.48
104 0.52
105 0.51
106 0.6
107 0.62
108 0.67
109 0.62
110 0.55
111 0.51
112 0.47
113 0.39
114 0.32
115 0.32
116 0.26
117 0.26
118 0.25
119 0.21
120 0.2
121 0.18
122 0.17
123 0.17
124 0.18
125 0.22
126 0.22
127 0.24
128 0.24
129 0.25
130 0.27
131 0.24
132 0.24
133 0.21
134 0.21
135 0.21
136 0.2
137 0.19
138 0.17
139 0.17
140 0.18
141 0.23
142 0.25
143 0.25
144 0.3
145 0.32
146 0.33
147 0.33
148 0.3
149 0.3
150 0.31
151 0.32
152 0.32
153 0.33
154 0.33
155 0.37
156 0.37
157 0.32
158 0.28
159 0.23
160 0.17
161 0.14
162 0.13
163 0.09
164 0.09
165 0.07
166 0.06
167 0.06
168 0.05
169 0.05
170 0.04
171 0.03
172 0.02
173 0.02
174 0.03
175 0.03
176 0.03
177 0.03
178 0.04
179 0.04
180 0.04
181 0.06
182 0.06
183 0.06
184 0.06
185 0.08
186 0.09
187 0.1
188 0.13
189 0.14
190 0.16
191 0.15
192 0.15
193 0.13
194 0.12
195 0.11
196 0.08
197 0.06
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.06
205 0.07
206 0.06
207 0.06
208 0.07
209 0.07
210 0.07
211 0.07
212 0.07
213 0.07
214 0.08
215 0.09
216 0.11
217 0.12
218 0.13
219 0.14
220 0.16
221 0.2
222 0.24
223 0.32
224 0.31
225 0.32
226 0.31
227 0.31
228 0.28
229 0.22
230 0.18
231 0.09
232 0.08
233 0.07
234 0.07
235 0.06
236 0.07
237 0.11
238 0.16
239 0.2
240 0.28
241 0.36
242 0.43
243 0.47
244 0.55
245 0.61
246 0.63
247 0.68
248 0.7
249 0.69
250 0.65
251 0.6
252 0.52
253 0.43
254 0.36
255 0.27
256 0.18
257 0.1
258 0.06
259 0.05
260 0.05
261 0.04
262 0.05
263 0.05
264 0.05
265 0.08
266 0.12
267 0.16
268 0.22
269 0.33
270 0.42
271 0.5
272 0.6
273 0.66
274 0.73
275 0.8
276 0.8
277 0.78
278 0.74
279 0.69
280 0.6
281 0.54
282 0.45
283 0.35
284 0.3
285 0.22
286 0.17
287 0.16
288 0.15
289 0.11
290 0.12
291 0.12
292 0.13
293 0.13