Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401GE42

Protein Details
Accession A0A401GE42    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
5-33LSPKALTPKKAGKVKKKGKSVRKVTGKVAHydrophilic
NLS Segment(s)
PositionSequence
10-47LTPKKAGKVKKKGKSVRKVTGKVASKATKGKAAPGGAK
Subcellular Location(s) nucl 14.5, cyto_nucl 9.5, mito 9
Family & Domain DBs
Amino Acid Sequences MAKLLSPKALTPKKAGKVKKKGKSVRKVTGKVASKATKGKAAPGGAKGGGCKCKMKDAYNSEDDSRSSQDSHRSSPDIPSMGSEEDLASDEDSEDGESIIVNKGKGKTVATTNGHKSTNGSAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.69
3 0.7
4 0.74
5 0.82
6 0.83
7 0.85
8 0.86
9 0.88
10 0.89
11 0.88
12 0.87
13 0.87
14 0.82
15 0.77
16 0.77
17 0.72
18 0.65
19 0.63
20 0.56
21 0.5
22 0.51
23 0.46
24 0.43
25 0.37
26 0.37
27 0.34
28 0.33
29 0.32
30 0.28
31 0.28
32 0.23
33 0.23
34 0.2
35 0.19
36 0.21
37 0.2
38 0.22
39 0.2
40 0.27
41 0.3
42 0.32
43 0.37
44 0.38
45 0.42
46 0.42
47 0.43
48 0.37
49 0.34
50 0.31
51 0.24
52 0.21
53 0.16
54 0.14
55 0.14
56 0.21
57 0.22
58 0.24
59 0.25
60 0.26
61 0.26
62 0.27
63 0.29
64 0.22
65 0.2
66 0.18
67 0.17
68 0.15
69 0.15
70 0.13
71 0.09
72 0.09
73 0.1
74 0.09
75 0.07
76 0.07
77 0.06
78 0.06
79 0.06
80 0.06
81 0.05
82 0.05
83 0.05
84 0.04
85 0.05
86 0.09
87 0.1
88 0.11
89 0.15
90 0.16
91 0.2
92 0.22
93 0.23
94 0.23
95 0.28
96 0.36
97 0.37
98 0.43
99 0.47
100 0.51
101 0.5
102 0.47
103 0.44