Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A401H342

Protein Details
Accession A0A401H342    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
139-162PEEKAPLRRRRAGRKSSAKKLQAAHydrophilic
NLS Segment(s)
PositionSequence
48-68RHSARSPARGKRARSPSSARS
142-158KAPLRRRRAGRKSSAKK
Subcellular Location(s) nucl 14, mito 7, cyto 5
Family & Domain DBs
Amino Acid Sequences MSAPVDIVRPSSAFVTSDVPSGSPTGKYVPIHKRSASVAPSCGSSPPRHSARSPARGKRARSPSSARSPSSSAVPRARVARPATPIPTHHTIPIYSIPELIALSASPLVQLPSVQRERMVHLFPTIVSHTVSAPTASAPEEKAPLRRRRAGRKSSAKKLQAANVSTDVESRRRRHGAWGWHEHVPLEDSWRHPAVVAVSV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.17
3 0.16
4 0.18
5 0.17
6 0.15
7 0.15
8 0.16
9 0.16
10 0.12
11 0.13
12 0.14
13 0.19
14 0.21
15 0.29
16 0.37
17 0.43
18 0.47
19 0.47
20 0.47
21 0.45
22 0.5
23 0.46
24 0.39
25 0.35
26 0.3
27 0.31
28 0.29
29 0.28
30 0.25
31 0.23
32 0.25
33 0.3
34 0.34
35 0.36
36 0.36
37 0.43
38 0.5
39 0.57
40 0.61
41 0.61
42 0.67
43 0.71
44 0.74
45 0.73
46 0.74
47 0.68
48 0.65
49 0.64
50 0.62
51 0.66
52 0.67
53 0.58
54 0.51
55 0.49
56 0.44
57 0.42
58 0.38
59 0.32
60 0.31
61 0.32
62 0.31
63 0.32
64 0.32
65 0.32
66 0.32
67 0.31
68 0.31
69 0.31
70 0.32
71 0.3
72 0.3
73 0.3
74 0.31
75 0.28
76 0.26
77 0.24
78 0.2
79 0.21
80 0.23
81 0.19
82 0.15
83 0.14
84 0.13
85 0.12
86 0.12
87 0.1
88 0.06
89 0.03
90 0.04
91 0.04
92 0.04
93 0.03
94 0.04
95 0.04
96 0.04
97 0.05
98 0.06
99 0.12
100 0.14
101 0.14
102 0.16
103 0.16
104 0.21
105 0.24
106 0.24
107 0.18
108 0.17
109 0.17
110 0.16
111 0.17
112 0.14
113 0.12
114 0.1
115 0.1
116 0.1
117 0.1
118 0.11
119 0.08
120 0.07
121 0.06
122 0.07
123 0.08
124 0.08
125 0.08
126 0.09
127 0.13
128 0.14
129 0.22
130 0.3
131 0.38
132 0.44
133 0.51
134 0.59
135 0.67
136 0.76
137 0.77
138 0.79
139 0.82
140 0.84
141 0.86
142 0.87
143 0.81
144 0.77
145 0.72
146 0.68
147 0.64
148 0.56
149 0.5
150 0.43
151 0.4
152 0.34
153 0.32
154 0.28
155 0.28
156 0.34
157 0.34
158 0.39
159 0.42
160 0.43
161 0.5
162 0.55
163 0.58
164 0.6
165 0.66
166 0.62
167 0.62
168 0.61
169 0.52
170 0.45
171 0.37
172 0.28
173 0.24
174 0.24
175 0.22
176 0.27
177 0.28
178 0.27
179 0.25
180 0.26